Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|720
Gene name
LocationContig_1239:2353..3156
Strand-
Gene length (bp)803
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04511 DER1 Der1-like family 1.8E-47 19 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 12 215 4.0E-50
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 12 215 7.0E-50
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 12 215 7.0E-50
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 16 223 1.0E-44
sp|Q851X7|DERL2_ORYSJ Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1 12 243 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 12 215 4.0E-50
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 12 215 7.0E-50
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 12 215 7.0E-50
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 16 223 1.0E-44
sp|Q851X7|DERL2_ORYSJ Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1 12 243 2.0E-44
sp|Q9ZS88|DER22_ARATH Derlin-2.2 OS=Arabidopsis thaliana GN=DER2.2 PE=2 SV=1 12 225 3.0E-44
sp|Q4G2J3|DER22_MAIZE Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1 12 237 7.0E-44
sp|Q4G2J4|DER21_MAIZE Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2 12 237 7.0E-44
sp|Q0P5E4|DERL3_BOVIN Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1 12 212 1.0E-42
sp|Q9D8K3|DERL3_MOUSE Derlin-3 OS=Mus musculus GN=Derl3 PE=1 SV=1 12 212 2.0E-42
sp|Q8VZ96|DER21_ARATH Derlin-2.1 OS=Arabidopsis thaliana GN=DER2.1 PE=2 SV=3 12 225 2.0E-41
sp|Q54NN1|DERL2_DICDI Probable derlin-2 homolog OS=Dictyostelium discoideum GN=derl2 PE=3 SV=1 11 228 2.0E-39
sp|Q21997|DERL2_CAEEL Derlin-2 OS=Caenorhabditis elegans GN=der-2 PE=2 SV=2 18 226 5.0E-36
sp|Q4G2J6|DER11_MAIZE Derlin-1.1 OS=Zea mays GN=DER1.1 PE=2 SV=2 15 214 4.0E-32
sp|Q4G2J5|DER12_MAIZE Derlin-1.2 OS=Zea mays GN=DER1.2 PE=2 SV=1 15 214 4.0E-32
sp|Q06397|DERL1_ORYSJ Derlin-1 OS=Oryza sativa subsp. japonica GN=DER1 PE=2 SV=2 15 229 1.0E-28
sp|O94458|YFFH_SCHPO Uncharacterized derlin-like protein C1687.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.17c PE=3 SV=2 18 193 3.0E-28
sp|Q8VZU9|DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana GN=DER1 PE=2 SV=1 18 218 2.0E-26
sp|Q9BUN8|DERL1_HUMAN Derlin-1 OS=Homo sapiens GN=DERL1 PE=1 SV=1 15 213 3.0E-22
sp|Q9VQ57|DERL1_DROME Derlin-1 OS=Drosophila melanogaster GN=Der-1 PE=2 SV=1 14 214 3.0E-22
sp|Q5R9W3|DERL1_PONAB Derlin-1 OS=Pongo abelii GN=DERL1 PE=2 SV=1 15 213 5.0E-22
sp|Q71SS4|DERL1_BOVIN Derlin-1 OS=Bos taurus GN=DERL1 PE=2 SV=1 15 213 7.0E-22
sp|Q99J56|DERL1_MOUSE Derlin-1 OS=Mus musculus GN=Derl1 PE=1 SV=1 15 213 3.0E-21
sp|Q93561|DERL1_CAEEL Derlin-1 OS=Caenorhabditis elegans GN=cup-2 PE=2 SV=1 10 243 6.0E-19
sp|Q54IC9|DERL1_DICDI Probable derlin-1 homolog OS=Dictyostelium discoideum GN=derl1 PE=3 SV=1 15 216 2.0E-15
sp|Q9Y7Y0|YGR8_SCHPO Uncharacterized derlin-like protein C365.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC365.08c PE=3 SV=1 18 204 1.0E-13
sp|P38307|DER1_YEAST Degradation in the endoplasmic reticulum protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DER1 PE=1 SV=3 18 213 4.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 62 84 22
3 104 126 22
4 146 168 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|720
MDQVIDGGRLPLEIWFWEMPICTRWWTAATVFTSALVQCHMVTPFQLFYSFRAVFIKSQYWRLVTTFLYFGPFSL
DLLFHIYFLQRYARLLEESSGRSPAHFSWLLLYAMASLIALSPLVSMPFLGHPLSSTLVYIWSRRNPDTRLSFLG
LVVFTAPYLPWVLMAFSLFMHGSVPRDEIMGVVIGHIWYFYTDVYPPLHNGSTPLDPPTWWRRIFRGWASEDSRP
GIDNEVVAAGGREQAPAAPDALG*
Coding >Ophun1|720
ATGGATCAAGTCATAGACGGTGGTCGCCTTCCTCTAGAGATCTGGTTCTGGGAGATGCCCATCTGCACGCGGTGG
TGGACTGCGGCTACCGTCTTCACAAGTGCGCTGGTTCAGTGTCACATGGTGACACCGTTCCAACTCTTCTACAGT
TTCCGTGCTGTATTTATCAAGTCGCAGTATTGGCGGCTCGTGACGACGTTCCTCTACTTTGGGCCTTTTTCTCTT
GATCTCCTGTTTCACATCTACTTTCTTCAACGCTATGCCCGTCTTCTGGAAGAATCCTCTGGCCGCTCTCCCGCT
CATTTCTCTTGGCTCCTCCTATACGCCATGGCAAGCCTCATCGCTCTTTCGCCCCTGGTCTCAATGCCGTTTCTG
GGCCATCCTCTCTCATCGACCTTGGTTTATATATGGTCTCGACGAAATCCGGACACGAGGTTAAGTTTTTTGGGA
CTGGTTGTCTTCACCGCACCTTATTTACCTTGGGTTCTCATGGCTTTCAGCCTCTTCATGCATGGCTCTGTTCCG
CGCGATGAAATCATGGGTGTTGTTATTGGACATATCTGGTACTTTTACACGGACGTATATCCGCCCCTACACAAC
GGCTCCACGCCTCTCGACCCTCCAACATGGTGGAGGCGAATCTTCCGAGGTTGGGCTTCAGAGGATTCTCGTCCC
GGTATCGACAATGAAGTCGTCGCGGCTGGTGGACGAGAACAAGCGCCAGCGGCACCCGATGCATTAGGGTAG
Transcript >Ophun1|720
ATGGATCAAGTCATAGACGGTGGTCGCCTTCCTCTAGAGATCTGGTTCTGGGAGATGCCCATCTGCACGCGGTGG
TGGACTGCGGCTACCGTCTTCACAAGTGCGCTGGTTCAGTGTCACATGGTGACACCGTTCCAACTCTTCTACAGT
TTCCGTGCTGTATTTATCAAGTCGCAGTATTGGCGGCTCGTGACGACGTTCCTCTACTTTGGGCCTTTTTCTCTT
GATCTCCTGTTTCACATCTACTTTCTTCAACGCTATGCCCGTCTTCTGGAAGAATCCTCTGGCCGCTCTCCCGCT
CATTTCTCTTGGCTCCTCCTATACGCCATGGCAAGCCTCATCGCTCTTTCGCCCCTGGTCTCAATGCCGTTTCTG
GGCCATCCTCTCTCATCGACCTTGGTTTATATATGGTCTCGACGAAATCCGGACACGAGGTTAAGTTTTTTGGGA
CTGGTTGTCTTCACCGCACCTTATTTACCTTGGGTTCTCATGGCTTTCAGCCTCTTCATGCATGGCTCTGTTCCG
CGCGATGAAATCATGGGTGTTGTTATTGGACATATCTGGTACTTTTACACGGACGTATATCCGCCCCTACACAAC
GGCTCCACGCCTCTCGACCCTCCAACATGGTGGAGGCGAATCTTCCGAGGTTGGGCTTCAGAGGATTCTCGTCCC
GGTATCGACAATGAAGTCGTCGCGGCTGGTGGACGAGAACAAGCGCCAGCGGCACCCGATGCATTAGGGTAG
Gene >Ophun1|720
ATGGATCAAGTCATAGACGGTGGTCGCCTTCCTCTAGAGATCTGGTTCTGGGAGATGCCCATCTGCACGCGGTGG
TGGACTGCGGCTACCGTCTTCACAAGTGCGCTGGTTCAGTGTCACATGGTGACACCGTTCCAACTCTTCTACAGT
TTCCGTGCTGTATTTATCAAGTCGCAGGTGAGTTCAGCCCTTGTTGCGGCACAGAGAATGGCTGATAATGATGAG
ACTTGCAGTATTGGCGGCTCGTGACGACGTTCCTCTACTTTGGGCCTTTTTCTCTTGATCTCCTGTTTCACATCT
ACTTTCTTCAACGCTATGCCCGTCTTCTGGAAGAATCCTCTGGCCGCTCTCCCGCTCATTTCTCTTGGCTCCTCC
TATACGCCATGGCAAGCCTCATCGCTCTTTCGCCCCTGGTCTCAATGCCGTTTCTGGGCCATCCTCTCTCATCGA
CCTTGGTTTATATATGGTCTCGACGAAATCCGGACACGAGGTTAAGTTTTTTGGGACTGGTTGTCTTCACCGCAC
CTTATTTACCTTGGGTTCTCATGGCTTTCAGCCTCTTCATGCATGGCTCTGTTCCGCGCGATGAAATCATGGGTG
TTGTTATTGGACATATCTGGTACTTTTACACGGACGTATATCCGCCCCTACACAACGGCTCCACGCCTCTCGACC
CTCCAACATGGTGGAGGCGAATCTTCCGAGGTTGGGCTTCAGAGGATTCTCGTCCCGGTATCGACAATGAAGTCG
TCGCGGCTGGTGGACGAGAACAAGCGCCAGCGGCACCCGATGCATTAGGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail