Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7198
Gene name
LocationContig_871:1916..6262
Strand+
Gene length (bp)4346
Transcript length (bp)4290
Coding sequence length (bp)4290
Protein length (aa) 1430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 3.2E-33 928 1085
PF11987 IF-2 Translation-initiation factor 2 3.4E-25 1248 1342
PF01926 MMR_HSR1 50S ribosome-binding GTPase 5.7E-10 928 1034
PF00025 Arf ADP-ribosylation factor family 2.7E-05 930 1083

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 845 1408 3.0E-130
sp|O59683|IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 845 1410 1.0E-119
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 788 1410 2.0E-116
sp|Q2RMS0|IF2_RHORT Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 827 1407 1.0E-115
sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 771 1406 5.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 845 1408 3.0E-130
sp|O59683|IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 845 1410 1.0E-119
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 788 1410 2.0E-116
sp|Q2RMS0|IF2_RHORT Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 827 1407 1.0E-115
sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 771 1406 5.0E-115
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 841 1408 1.0E-114
sp|B0CK11|IF2_BRUSI Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 841 1408 1.0E-114
sp|Q57AA0|IF2_BRUAB Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 841 1408 1.0E-114
sp|Q2YQR7|IF2_BRUA2 Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 841 1408 1.0E-114
sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 841 1408 1.0E-114
sp|Q8YEB3|IF2_BRUME Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 841 1408 2.0E-114
sp|A5VTB2|IF2_BRUO2 Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 841 1408 2.0E-114
sp|Q8FXT2|IF2_BRUSU Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 841 1408 2.0E-114
sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 828 1408 2.0E-114
sp|B4RC55|IF2_PHEZH Translation initiation factor IF-2 OS=Phenylobacterium zucineum (strain HLK1) GN=infB PE=3 SV=1 841 1406 2.0E-114
sp|Q5FQM3|IF2_GLUOX Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 828 1408 2.0E-114
sp|Q2SVG8|IF2_BURTA Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 837 1410 3.0E-114
sp|A9M9Z4|IF2_BRUC2 Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 841 1408 4.0E-114
sp|A4JDX1|IF2_BURVG Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 837 1408 7.0E-114
sp|Q63TP8|IF2_BURPS Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 837 1410 1.0E-113
sp|A3N8V8|IF2_BURP6 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 837 1410 1.0E-113
sp|Q3JSY9|IF2_BURP1 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 837 1410 1.0E-113
sp|A3NUL0|IF2_BURP0 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 837 1410 2.0E-113
sp|B2T381|IF2_BURPP Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 837 1410 3.0E-113
sp|P44323|IF2_HAEIN Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 843 1408 3.0E-113
sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 841 1408 4.0E-113
sp|Q140U6|IF2_BURXL Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 837 1410 4.0E-113
sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 837 1410 5.0E-113
sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 837 1410 5.0E-113
sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 837 1410 5.0E-113
sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 837 1410 5.0E-113
sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 768 1408 6.0E-113
sp|A5UBT6|IF2_HAEIE Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 843 1408 1.0E-112
sp|A4SJR5|IF2_AERS4 Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 841 1408 1.0E-112
sp|A7HZ93|IF2_PARL1 Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 840 1408 2.0E-112
sp|A0K6X5|IF2_BURCH Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 837 1408 2.0E-112
sp|Q1BWS7|IF2_BURCA Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 837 1408 2.0E-112
sp|B1K0M0|IF2_BURCC Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 837 1408 2.0E-112
sp|Q6G0P2|IF2_BARQU Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 841 1408 3.0E-112
sp|Q39H30|IF2_BURL3 Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 837 1408 3.0E-112
sp|B1MZH4|IF2_LEUCK Translation initiation factor IF-2 OS=Leuconostoc citreum (strain KM20) GN=infB PE=3 SV=1 849 1408 3.0E-112
sp|B4E7L1|IF2_BURCJ Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 837 1408 3.0E-112
sp|Q0BFY3|IF2_BURCM Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 837 1408 4.0E-112
sp|A6WWW5|IF2_OCHA4 Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 841 1408 6.0E-112
sp|B2JKT4|IF2_BURP8 Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 837 1410 7.0E-112
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 841 1408 8.0E-112
sp|Q5LWL4|IF2_RUEPO Translation initiation factor IF-2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=infB PE=3 SV=1 834 1407 9.0E-112
sp|Q92SW4|IF2_RHIME Translation initiation factor IF-2 OS=Rhizobium meliloti (strain 1021) GN=infB PE=3 SV=1 841 1408 1.0E-111
sp|Q4QK37|IF2_HAEI8 Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 843 1408 1.0E-111
sp|A8IG20|IF2_AZOC5 Translation initiation factor IF-2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=infB PE=3 SV=1 840 1408 1.0E-111
sp|A5UF34|IF2_HAEIG Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 843 1408 1.0E-111
sp|B3PXE3|IF2_RHIE6 Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 780 1408 2.0E-111
sp|A6UF29|IF2_SINMW Translation initiation factor IF-2 OS=Sinorhizobium medicae (strain WSM419) GN=infB PE=3 SV=1 841 1408 2.0E-111
sp|B1YP36|IF2_BURA4 Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 837 1408 2.0E-111
sp|Q0BPG2|IF2_GRABC Translation initiation factor IF-2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=infB PE=3 SV=1 828 1408 2.0E-111
sp|B9JYK6|IF2_AGRVS Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 840 1408 2.0E-111
sp|C1D8X2|IF2_LARHH Translation initiation factor IF-2 OS=Laribacter hongkongensis (strain HLHK9) GN=infB PE=3 SV=1 837 1410 3.0E-111
sp|A9ABD5|IF2_BURM1 Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 837 1408 3.0E-111
sp|Q8RA37|IF2_CALS4 Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 834 1408 4.0E-111
sp|Q8UJ51|IF2_AGRFC Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 783 1408 5.0E-111
sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=infB PE=3 SV=1 847 1408 7.0E-111
sp|Q2VZV0|IF2_MAGSA Translation initiation factor IF-2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=infB PE=3 SV=1 793 1407 7.0E-111
sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 771 1408 1.0E-110
sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 836 1410 2.0E-110
sp|Q11BC8|IF2_CHESB Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 841 1408 3.0E-110
sp|C5D9C9|IF2_GEOSW Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 833 1410 3.0E-110
sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 841 1408 5.0E-110
sp|B1XV89|IF2_POLNS Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=infB PE=3 SV=1 837 1410 5.0E-110
sp|Q1LLR6|IF2_CUPMC Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 837 1410 6.0E-110
sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=infB PE=3 SV=2 810 1406 7.0E-110
sp|B1XI09|IF2_SYNP2 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=infB PE=3 SV=1 829 1410 9.0E-110
sp|Q4UL51|IF2_RICFE Translation initiation factor IF-2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=infB PE=3 SV=1 824 1408 2.0E-109
sp|P57873|IF2_PASMU Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 694 1408 2.0E-109
sp|Q38W81|IF2_LACSS Translation initiation factor IF-2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=infB PE=3 SV=1 836 1408 2.0E-109
sp|B1ZDQ8|IF2_METPB Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 841 1408 2.0E-109
sp|Q6NCN5|IF2_RHOPA Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 840 1408 2.0E-109
sp|A0LE19|IF2_MAGMM Translation initiation factor IF-2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=infB PE=3 SV=1 798 1407 2.0E-109
sp|A1K7B9|IF2_AZOSB Translation initiation factor IF-2 OS=Azoarcus sp. (strain BH72) GN=infB PE=3 SV=1 837 1408 2.0E-109
sp|B2UAA3|IF2_RALPJ Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 837 1410 2.0E-109
sp|P46198|IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus GN=MTIF2 PE=1 SV=1 820 1407 2.0E-109
sp|A8GSP4|IF2_RICRS Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=infB PE=3 SV=1 824 1408 3.0E-109
sp|B0BY61|IF2_RICRO Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Iowa) GN=infB PE=3 SV=1 824 1408 3.0E-109
sp|B7GG75|IF2_ANOFW Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 862 1410 3.0E-109
sp|Q9ZCZ8|IF2_RICPR Translation initiation factor IF-2 OS=Rickettsia prowazekii (strain Madrid E) GN=infB PE=3 SV=1 824 1408 3.0E-109
sp|A5E866|IF2_BRASB Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 840 1408 4.0E-109
sp|A8LQ56|IF2_DINSH Translation initiation factor IF-2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=infB PE=3 SV=1 840 1407 5.0E-109
sp|B8HUA9|IF2_CYAP4 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=infB PE=3 SV=1 782 1407 5.0E-109
sp|B8EIA7|IF2_METSB Translation initiation factor IF-2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=infB PE=3 SV=1 805 1408 6.0E-109
sp|Q89WA9|IF2_BRADU Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 840 1408 7.0E-109
sp|Q7NY13|IF2_CHRVO Translation initiation factor IF-2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=infB PE=3 SV=1 837 1428 7.0E-109
sp|Q4FVL5|IF2_PSYA2 Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 836 1408 8.0E-109
sp|B0BNR5|IF2_ACTPJ Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 843 1408 9.0E-109
sp|C0QTL9|IF2_PERMH Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 844 1408 1.0E-108
sp|B3R1E4|IF2_CUPTR Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 837 1410 1.0E-108
sp|A4YJE9|IF2_BRASO Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 804 1408 1.0E-108
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 793 1408 1.0E-108
sp|Q91YJ5|IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus GN=Mtif2 PE=1 SV=2 820 1407 1.0E-108
sp|Q1GXD6|IF2_METFK Translation initiation factor IF-2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=infB PE=3 SV=1 837 1410 1.0E-108
sp|Q97I51|IF2_CLOAB Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 842 1408 2.0E-108
sp|Q1QEP5|IF2_PSYCK Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 836 1408 2.0E-108
sp|A1B587|IF2_PARDP Translation initiation factor IF-2 OS=Paracoccus denitrificans (strain Pd 1222) GN=infB PE=3 SV=1 819 1407 2.0E-108
sp|A6VNE0|IF2_ACTSZ Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 843 1408 2.0E-108
sp|Q9ZF25|IF2_ENTCL Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 841 1408 2.0E-108
sp|A9ITX6|IF2_BORPD Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 841 1410 2.0E-108
sp|A4SY78|IF2_POLSQ Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 837 1410 2.0E-108
sp|Q7V5M4|IF2_PROMM Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9313) GN=infB PE=3 SV=1 843 1427 3.0E-108
sp|B3H163|IF2_ACTP7 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 843 1408 3.0E-108
sp|A3N005|IF2_ACTP2 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 843 1408 3.0E-108
sp|P04766|IF2_GEOSE Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 836 1410 3.0E-108
sp|A2C6Q5|IF2_PROM3 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9303) GN=infB PE=3 SV=1 843 1427 4.0E-108
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 841 1408 4.0E-108
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 841 1408 4.0E-108
sp|Q11PK5|IF2_CYTH3 Translation initiation factor IF-2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=infB PE=3 SV=1 828 1407 4.0E-108
sp|B0K9Q0|IF2_THEP3 Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 840 1408 4.0E-108
sp|Q68WI4|IF2_RICTY Translation initiation factor IF-2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=infB PE=3 SV=1 824 1408 4.0E-108
sp|A1U600|IF2_MARHV Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 837 1408 5.0E-108
sp|A9KNW4|IF2_CLOPH Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 840 1407 5.0E-108
sp|A5CEN6|IF2_ORITB Translation initiation factor IF-2 OS=Orientia tsutsugamushi (strain Boryong) GN=infB PE=3 SV=1 819 1407 6.0E-108
sp|Q2KXY7|IF2_BORA1 Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 834 1410 6.0E-108
sp|A8GNW1|IF2_RICAH Translation initiation factor IF-2 OS=Rickettsia akari (strain Hartford) GN=infB PE=3 SV=1 824 1408 6.0E-108
sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 841 1427 7.0E-108
sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 843 1415 8.0E-108
sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 841 1427 8.0E-108
sp|Q03WH4|IF2_LEUMM Translation initiation factor IF-2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=infB PE=3 SV=1 723 1408 9.0E-108
sp|Q16D38|IF2_ROSDO Translation initiation factor IF-2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=infB PE=3 SV=1 840 1407 9.0E-108
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 837 1408 9.0E-108
sp|Q0K9B9|IF2_CUPNH Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 837 1410 1.0E-107
sp|A0KTZ6|IF2_SHESA Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 841 1408 1.0E-107
sp|A8F223|IF2_RICM5 Translation initiation factor IF-2 OS=Rickettsia massiliae (strain Mtu5) GN=infB PE=3 SV=1 824 1408 1.0E-107
sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 815 1408 1.0E-107
sp|P46199|IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens GN=MTIF2 PE=1 SV=2 907 1407 2.0E-107
sp|Q04U31|IF2_LEPBJ Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=infB PE=3 SV=1 841 1408 3.0E-107
sp|Q04ZJ5|IF2_LEPBL Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=infB PE=3 SV=1 841 1408 4.0E-107
sp|B8I6E7|IF2_CLOCE Translation initiation factor IF-2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=infB PE=3 SV=1 837 1408 4.0E-107
sp|Q5QTY8|IF2_IDILO Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 837 1408 4.0E-107
sp|Q1QS64|IF2_NITHX Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 840 1408 4.0E-107
sp|Q92HF5|IF2_RICCN Translation initiation factor IF-2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=infB PE=3 SV=1 824 1408 4.0E-107
sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 841 1408 5.0E-107
sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 836 1410 6.0E-107
sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 840 1408 7.0E-107
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 841 1408 8.0E-107
sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 841 1408 8.0E-107
sp|Q98BI8|IF2_RHILO Translation initiation factor IF-2 OS=Rhizobium loti (strain MAFF303099) GN=infB PE=3 SV=1 819 1407 9.0E-107
sp|B2IIJ7|IF2_BEII9 Translation initiation factor IF-2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=infB PE=3 SV=1 820 1408 1.0E-106
sp|Q8EHL5|IF2_SHEON Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 841 1408 1.0E-106
sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 843 1415 1.0E-106
sp|Q0C5Z5|IF2_HYPNA Translation initiation factor IF-2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=infB PE=3 SV=1 843 1408 1.0E-106
sp|Q73NP6|IF2_TREDE Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 841 1408 1.0E-106
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 841 1408 1.0E-106
sp|A1AV99|IF2_RUTMC Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 840 1407 1.0E-106
sp|B0UU13|IF2_HISS2 Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 843 1408 1.0E-106
sp|B2J955|IF2_NOSP7 Translation initiation factor IF-2 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=infB PE=3 SV=1 865 1410 2.0E-106
sp|Q0AK69|IF2_MARMM Translation initiation factor IF-2 OS=Maricaulis maris (strain MCS10) GN=infB PE=3 SV=1 841 1408 2.0E-106
sp|Q1RIX0|IF2_RICBR Translation initiation factor IF-2 OS=Rickettsia bellii (strain RML369-C) GN=infB PE=3 SV=1 824 1408 2.0E-106
sp|Q74CT3|IF2_GEOSL Translation initiation factor IF-2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=infB PE=3 SV=1 841 1408 2.0E-106
sp|Q0I3P5|IF2_HAES1 Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 843 1408 2.0E-106
sp|A8GW31|IF2_RICB8 Translation initiation factor IF-2 OS=Rickettsia bellii (strain OSU 85-389) GN=infB PE=3 SV=1 843 1408 2.0E-106
sp|Q3J9B6|IF2_NITOC Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 838 1408 2.0E-106
sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 782 1408 2.0E-106
sp|B0K1D6|IF2_THEPX Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 845 1408 3.0E-106
sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 843 1410 3.0E-106
sp|Q5NZS1|IF2_AROAE Translation initiation factor IF-2 OS=Aromatoleum aromaticum (strain EbN1) GN=infB PE=3 SV=1 837 1408 3.0E-106
sp|Q482T9|IF2_COLP3 Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 839 1408 3.0E-106
sp|Q7NH85|IF2_GLOVI Translation initiation factor IF-2 OS=Gloeobacter violaceus (strain PCC 7421) GN=infB PE=3 SV=1 841 1410 4.0E-106
sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 754 1408 4.0E-106
sp|Q1GCH2|IF2_RUEST Translation initiation factor IF-2 OS=Ruegeria sp. (strain TM1040) GN=infB PE=3 SV=1 840 1407 4.0E-106
sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 837 1408 4.0E-106
sp|A3QGU5|IF2_SHELP Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 841 1408 4.0E-106
sp|B0TWR3|IF2_FRAP2 Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 840 1407 5.0E-106
sp|Q65SK9|IF2_MANSM Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 841 1408 5.0E-106
sp|Q28WF7|IF2_JANSC Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 840 1407 5.0E-106
sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 921 1412 7.0E-106
sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 843 1410 8.0E-106
sp|C5BFB7|IF2_EDWI9 Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 841 1408 8.0E-106
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 843 1410 8.0E-106
sp|Q47D94|IF2_DECAR Translation initiation factor IF-2 OS=Dechloromonas aromatica (strain RCB) GN=infB PE=3 SV=1 837 1410 1.0E-105
sp|Q21C31|IF2_RHOPB Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 840 1408 1.0E-105
sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 840 1428 2.0E-105
sp|Q10XM3|IF2_TRIEI Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 834 1410 2.0E-105
sp|Q3SWP9|IF2_NITWN Translation initiation factor IF-2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=infB PE=3 SV=1 840 1408 2.0E-105
sp|Q2A1G8|IF2_FRATH Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 840 1407 2.0E-105
sp|A4XL70|IF2_CALS8 Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 836 1408 2.0E-105
sp|Q0BK70|IF2_FRATO Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 840 1407 2.0E-105
sp|A7NEI8|IF2_FRATF Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 840 1407 2.0E-105
sp|A8EYF4|IF2_RICCK Translation initiation factor IF-2 OS=Rickettsia canadensis (strain McKiel) GN=infB PE=3 SV=1 824 1408 3.0E-105
sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 840 1428 3.0E-105
sp|B3EAE7|IF2_GEOLS Translation initiation factor IF-2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=infB PE=3 SV=1 841 1408 3.0E-105
sp|Q5NIL7|IF2_FRATT Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 840 1407 4.0E-105
sp|Q14K20|IF2_FRAT1 Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 840 1407 4.0E-105
sp|A4IW10|IF2_FRATW Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 840 1407 4.0E-105
sp|Q5X1C3|IF2_LEGPA Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 838 1407 4.0E-105
sp|Q4UWA2|IF2_XANC8 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 838 1408 4.0E-105
sp|B2SEW7|IF2_FRATM Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 840 1407 5.0E-105
sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 841 1408 5.0E-105
sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 843 1408 6.0E-105
sp|B8ZM93|IF2_STRPJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=infB PE=3 SV=1 849 1408 6.0E-105
sp|B8DG02|IF2_LISMH Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=infB PE=3 SV=1 843 1408 6.0E-105
sp|A0Q8F3|IF2_FRATN Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 840 1407 7.0E-105
sp|Q3SKX1|IF2_THIDA Translation initiation factor IF-2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=infB PE=3 SV=1 824 1428 7.0E-105
sp|A5IHU7|IF2_LEGPC Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 838 1407 7.0E-105
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 843 1415 8.0E-105
sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 841 1408 8.0E-105
sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 841 1408 8.0E-105
sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 841 1408 8.0E-105
sp|B8E6N2|IF2_SHEB2 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 841 1408 8.0E-105
sp|Q7VLI2|IF2_HAEDU Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 840 1410 9.0E-105
sp|Q8F7K1|IF2_LEPIN Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=infB PE=3 SV=2 841 1408 9.0E-105
sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 827 1410 9.0E-105
sp|B5E266|IF2_STRP4 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|B9EBE9|IF2_MACCJ Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 836 1410 1.0E-104
sp|Q8P7U7|IF2_XANCP Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 838 1408 1.0E-104
sp|B0RRB4|IF2_XANCB Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 838 1408 1.0E-104
sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 843 1408 1.0E-104
sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 841 1410 1.0E-104
sp|Q46ZP1|IF2_CUPPJ Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 837 1393 1.0E-104
sp|B5YHT8|IF2_THEYD Translation initiation factor IF-2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=infB PE=3 SV=1 838 1408 1.0E-104
sp|Q72NX3|IF2_LEPIC Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=infB PE=3 SV=2 841 1408 1.0E-104
sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 843 1408 1.0E-104
sp|C1L2N1|IF2_LISMC Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 843 1408 1.0E-104
sp|C1CQ48|IF2_STRZT Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|C1C5S8|IF2_STRP7 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain 70585) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|C1CJ39|IF2_STRZP Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain P1031) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|B0VE81|IF2_ACIBY Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 836 1408 1.0E-104
sp|B2I2M7|IF2_ACIBC Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 836 1408 1.0E-104
sp|B7I3R9|IF2_ACIB5 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 836 1408 1.0E-104
sp|B7H115|IF2_ACIB3 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 836 1408 1.0E-104
sp|C1CCT8|IF2_STRZJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain JJA) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|Q8DQV2|IF2_STRR6 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|Q04LW0|IF2_STRP2 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|Q97S57|IF2_STRPN Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|B2IME4|IF2_STRPS Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain CGSP14) GN=infB PE=3 SV=1 849 1408 1.0E-104
sp|B0VLU2|IF2_ACIBS Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 836 1408 2.0E-104
sp|Q5ZRV4|IF2_LEGPH Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 838 1407 2.0E-104
sp|Q5WT36|IF2_LEGPL Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 838 1407 2.0E-104
sp|Q39VA6|IF2_GEOMG Translation initiation factor IF-2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=infB PE=3 SV=1 841 1408 2.0E-104
sp|Q7VYR2|IF2_BORPE Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 841 1410 2.0E-104
sp|A8G6Z5|IF2_PROM2 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9215) GN=infB PE=3 SV=1 843 1410 2.0E-104
sp|A3PEY3|IF2_PROM0 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9301) GN=infB PE=3 SV=1 843 1410 2.0E-104
sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 841 1408 2.0E-104
sp|P72689|IF2_SYNY3 Translation initiation factor IF-2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=infB PE=3 SV=1 834 1410 2.0E-104
sp|Q8PJ55|IF2_XANAC Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 838 1408 3.0E-104
sp|C4Z5N7|IF2_EUBE2 Translation initiation factor IF-2 OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=infB PE=3 SV=1 843 1407 3.0E-104
sp|Q8E1H3|IF2_STRA5 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=infB PE=3 SV=1 847 1408 3.0E-104
sp|A8FYS0|IF2_SHESH Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 840 1408 3.0E-104
sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 924 1406 3.0E-104
sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 843 1408 3.0E-104
sp|P0A3K7|IF2_STRAG Translation initiation factor IF-2 OS=Streptococcus agalactiae GN=infB PE=3 SV=1 847 1408 3.0E-104
sp|P0A3K6|IF2_STRA3 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=infB PE=3 SV=1 847 1408 3.0E-104
sp|Q3K302|IF2_STRA1 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=infB PE=3 SV=1 847 1408 3.0E-104
sp|B8CKH3|IF2_SHEPW Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 843 1408 4.0E-104
sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 841 1410 4.0E-104
sp|Q3BRP5|IF2_XANC5 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 838 1408 5.0E-104
sp|A8G907|IF2_SERP5 Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 841 1408 5.0E-104
sp|B1IA80|IF2_STRPI Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=infB PE=3 SV=1 849 1408 6.0E-104
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 843 1410 7.0E-104
sp|B4S4S6|IF2_PROA2 Translation initiation factor IF-2 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=infB PE=3 SV=1 815 1410 7.0E-104
sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 847 1412 8.0E-104
sp|B4SQS0|IF2_STRM5 Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 838 1408 8.0E-104
sp|C1DFK9|IF2_AZOVD Translation initiation factor IF-2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=infB PE=3 SV=1 838 1408 1.0E-103
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 843 1410 1.0E-103
sp|Q5GXU9|IF2_XANOR Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 838 1408 1.0E-103
sp|Q2P0X1|IF2_XANOM Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 838 1408 1.0E-103
sp|B2SVK3|IF2_XANOP Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 838 1408 1.0E-103
sp|Q086H2|IF2_SHEFN Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 841 1408 2.0E-103
sp|B2FN90|IF2_STRMK Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 838 1408 2.0E-103
sp|B9DPF5|IF2_STACT Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 834 1410 2.0E-103
sp|Q7U8L9|IF2_SYNPX Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 841 1410 2.0E-103
sp|B1HR05|IF2_LYSSC Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 839 1412 3.0E-103
sp|A1W8Z4|IF2_ACISJ Translation initiation factor IF-2 OS=Acidovorax sp. (strain JS42) GN=infB PE=3 SV=1 834 1407 3.0E-103
sp|Q31LL9|IF2_SYNE7 Translation initiation factor IF-2 OS=Synechococcus elongatus (strain PCC 7942) GN=infB PE=3 SV=1 826 1410 3.0E-103
sp|Q732Q9|IF2_BACC1 Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|B9IVA1|IF2_BACCQ Translation initiation factor IF-2 OS=Bacillus cereus (strain Q1) GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|B7HLE6|IF2_BACC7 Translation initiation factor IF-2 OS=Bacillus cereus (strain AH187) GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|Q8DBW0|IF2_VIBVU Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 843 1408 4.0E-103
sp|Q81WM3|IF2_BACAN Translation initiation factor IF-2 OS=Bacillus anthracis GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|C3L7B4|IF2_BACAC Translation initiation factor IF-2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|C3P5L5|IF2_BACAA Translation initiation factor IF-2 OS=Bacillus anthracis (strain A0248) GN=infB PE=3 SV=1 849 1410 4.0E-103
sp|Q2J2J9|IF2_RHOP2 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 840 1408 5.0E-103
sp|Q6HF02|IF2_BACHK Translation initiation factor IF-2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=infB PE=3 SV=1 849 1410 5.0E-103
sp|Q636L3|IF2_BACCZ Translation initiation factor IF-2 OS=Bacillus cereus (strain ZK / E33L) GN=infB PE=3 SV=1 849 1410 5.0E-103
sp|C1EP35|IF2_BACC3 Translation initiation factor IF-2 OS=Bacillus cereus (strain 03BB102) GN=infB PE=3 SV=1 849 1410 5.0E-103
sp|A0RHI4|IF2_BACAH Translation initiation factor IF-2 OS=Bacillus thuringiensis (strain Al Hakam) GN=infB PE=3 SV=2 849 1410 5.0E-103
sp|B3PI96|IF2_CELJU Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 807 1408 5.0E-103
sp|A5WBS5|IF2_PSYWF Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 836 1408 5.0E-103
sp|Q8KFT1|IF2_CHLTE Translation initiation factor IF-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=infB PE=3 SV=1 843 1410 6.0E-103
sp|C0MDY5|IF2_STRS7 Translation initiation factor IF-2 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=infB PE=3 SV=1 847 1408 6.0E-103
sp|Q8YQJ1|IF2_NOSS1 Translation initiation factor IF-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=infB PE=3 SV=1 865 1410 6.0E-103
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 843 1408 6.0E-103
sp|A9HF18|IF2_GLUDA Translation initiation factor IF-2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=infB PE=3 SV=1 840 1408 8.0E-103
sp|Q3MBZ7|IF2_ANAVT Translation initiation factor IF-2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=infB PE=3 SV=1 865 1410 9.0E-103
sp|B4U1E8|IF2_STREM Translation initiation factor IF-2 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=infB PE=3 SV=1 847 1408 9.0E-103
sp|Q0A797|IF2_ALKEH Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 837 1408 9.0E-103
sp|Q812X7|IF2_BACCR Translation initiation factor IF-2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=infB PE=3 SV=1 849 1410 1.0E-102
sp|B7HDT6|IF2_BACC4 Translation initiation factor IF-2 OS=Bacillus cereus (strain B4264) GN=infB PE=3 SV=1 849 1410 1.0E-102
sp|A5EWY9|IF2_DICNV Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 838 1408 1.0E-102
sp|Q7MI09|IF2_VIBVY Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 843 1408 1.0E-102
sp|Q2Y7W2|IF2_NITMU Translation initiation factor IF-2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=infB PE=3 SV=1 837 1410 1.0E-102
sp|P18311|IF2_ENTFC Translation initiation factor IF-2 OS=Enterococcus faecium GN=infB PE=3 SV=1 847 1408 2.0E-102
sp|A9VT50|IF2_BACWK Translation initiation factor IF-2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=infB PE=3 SV=1 849 1410 2.0E-102
sp|A7GRE3|IF2_BACCN Translation initiation factor IF-2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=infB PE=3 SV=1 924 1410 2.0E-102
sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 841 1407 2.0E-102
sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 843 1408 2.0E-102
sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 843 1408 2.0E-102
sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 843 1410 3.0E-102
sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 845 1406 3.0E-102
sp|B8FCY5|IF2_DESAA Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 843 1408 3.0E-102
sp|C1F697|IF2_ACIC5 Translation initiation factor IF-2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=infB PE=3 SV=1 838 1408 3.0E-102
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 837 1410 3.0E-102
sp|A8AVQ2|IF2_STRGC Translation initiation factor IF-2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=infB PE=3 SV=1 849 1408 4.0E-102
sp|A9M1D5|IF2_NEIM0 Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=infB PE=3 SV=1 837 1417 4.0E-102
sp|Q6FF40|IF2_ACIAD Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 836 1408 5.0E-102
sp|A1VG83|IF2_DESVV Translation initiation factor IF-2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=infB PE=3 SV=1 841 1408 5.0E-102
sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 841 1408 5.0E-102
sp|A1KV51|IF2_NEIMF Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=infB PE=3 SV=1 837 1417 5.0E-102
sp|Q1IF43|IF2_PSEE4 Translation initiation factor IF-2 OS=Pseudomonas entomophila (strain L48) GN=infB PE=3 SV=1 838 1408 6.0E-102
sp|B7KIU2|IF2_CYAP7 Translation initiation factor IF-2 OS=Cyanothece sp. (strain PCC 7424) GN=infB PE=3 SV=1 799 1410 6.0E-102
sp|A3CQ18|IF2_STRSV Translation initiation factor IF-2 OS=Streptococcus sanguinis (strain SK36) GN=infB PE=3 SV=1 849 1408 6.0E-102
sp|A1AMM1|IF2_PELPD Translation initiation factor IF-2 OS=Pelobacter propionicus (strain DSM 2379) GN=infB PE=3 SV=1 820 1408 6.0E-102
sp|B8JFY6|IF2_ANAD2 Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 841 1408 7.0E-102
sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 840 1410 7.0E-102
sp|C0M8P7|IF2_STRE4 Translation initiation factor IF-2 OS=Streptococcus equi subsp. equi (strain 4047) GN=infB PE=3 SV=1 847 1408 7.0E-102
sp|Q5WFU2|IF2_BACSK Translation initiation factor IF-2 OS=Bacillus clausii (strain KSM-K16) GN=infB PE=3 SV=1 851 1408 7.0E-102
sp|B9DVB7|IF2_STRU0 Translation initiation factor IF-2 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=infB PE=3 SV=1 847 1408 8.0E-102
sp|Q74IS8|IF2_LACJO Translation initiation factor IF-2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=infB PE=3 SV=1 836 1408 1.0E-101
sp|C0QHM2|IF2_DESAH Translation initiation factor IF-2 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=infB PE=3 SV=1 822 1403 1.0E-101
sp|Q7MXE4|IF2_PORGI Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=infB PE=3 SV=1 842 1408 1.0E-101
sp|C3LSP8|IF2_VIBCM Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 847 1408 1.0E-101
sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 847 1408 1.0E-101
sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 847 1408 1.0E-101
sp|B9M1G0|IF2_GEODF Translation initiation factor IF-2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=infB PE=3 SV=1 841 1408 1.0E-101
sp|B2RHM9|IF2_PORG3 Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=infB PE=3 SV=1 842 1408 1.0E-101
sp|B1KRR0|IF2_SHEWM Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 840 1408 1.0E-101
sp|Q1GVI9|IF2_SPHAL Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 840 1399 1.0E-101
sp|Q044B7|IF2_LACGA Translation initiation factor IF-2 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=infB PE=3 SV=1 836 1408 1.0E-101
sp|O67825|IF2_AQUAE Translation initiation factor IF-2 OS=Aquifex aeolicus (strain VF5) GN=infB PE=3 SV=1 842 1408 1.0E-101
sp|Q5N0A5|IF2_SYNP6 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=infB PE=3 SV=1 826 1410 1.0E-101
sp|B7IUH1|IF2_BACC2 Translation initiation factor IF-2 OS=Bacillus cereus (strain G9842) GN=infB PE=3 SV=1 924 1410 1.0E-101
sp|Q9JYD2|IF2_NEIMB Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=infB PE=3 SV=1 837 1417 1.0E-101
sp|P17889|IF2_BACSU Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 921 1412 1.0E-101
sp|C5BPV9|IF2_TERTT Translation initiation factor IF-2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=infB PE=3 SV=1 837 1408 1.0E-101
sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 841 1408 1.0E-101
sp|Q07V78|IF2_RHOP5 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisA53) GN=infB PE=3 SV=1 840 1408 1.0E-101
sp|Q89AF5|IF2_BUCBP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 820 1407 2.0E-101
sp|Q01W31|IF2_SOLUE Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 815 1408 2.0E-101
sp|B8J1Y4|IF2_DESDA Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 841 1408 2.0E-101
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 843 1408 2.0E-101
sp|A1BDF1|IF2_CHLPD Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=infB PE=3 SV=1 815 1410 2.0E-101
sp|Q30WJ0|IF2_DESAG Translation initiation factor IF-2 OS=Desulfovibrio alaskensis (strain G20) GN=infB PE=3 SV=1 841 1408 2.0E-101
sp|Q15V72|IF2_PSEA6 Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 837 1408 2.0E-101
sp|A0LHL8|IF2_SYNFM Translation initiation factor IF-2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=infB PE=3 SV=1 886 1408 3.0E-101
sp|B4RXT8|IF2_ALTMD Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 838 1408 3.0E-101
sp|B4RMZ3|IF2_NEIG2 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=infB PE=3 SV=1 837 1417 3.0E-101
sp|A0LV27|IF2_ACIC1 Translation initiation factor IF-2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=infB PE=3 SV=1 841 1429 3.0E-101
sp|Q13EL8|IF2_RHOPS Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB5) GN=infB PE=3 SV=1 840 1408 3.0E-101
sp|B8CW72|IF2_HALOH Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 905 1407 3.0E-101
sp|B5XSX4|IF2_KLEP3 Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 841 1408 3.0E-101
sp|B4UHG0|IF2_ANASK Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 841 1408 3.0E-101
sp|A6TEI7|IF2_KLEP7 Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 841 1408 3.0E-101
sp|A7Z4T4|IF2_BACMF Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 921 1412 4.0E-101
sp|Q8NZU7|IF2_STRP8 Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=infB PE=3 SV=1 847 1408 4.0E-101
sp|Q9JTB5|IF2_NEIMA Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=infB PE=3 SV=1 837 1417 4.0E-101
sp|Q5PAJ5|IF2_ANAMM Translation initiation factor IF-2 OS=Anaplasma marginale (strain St. Maries) GN=infB PE=3 SV=1 841 1412 5.0E-101
sp|A4VXH3|IF2_STRSY Translation initiation factor IF-2 OS=Streptococcus suis (strain 05ZYH33) GN=infB PE=3 SV=1 849 1408 5.0E-101
sp|A4W3R7|IF2_STRS2 Translation initiation factor IF-2 OS=Streptococcus suis (strain 98HAH33) GN=infB PE=3 SV=1 849 1408 5.0E-101
sp|Q1QSZ0|IF2_CHRSD Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 837 1408 5.0E-101
sp|Q9PGR3|IF2_XYLFA Translation initiation factor IF-2 OS=Xylella fastidiosa (strain 9a5c) GN=infB PE=3 SV=1 840 1408 5.0E-101
sp|B1XY67|IF2_LEPCP Translation initiation factor IF-2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=infB PE=3 SV=1 840 1410 6.0E-101
sp|C5CLW3|IF2_VARPS Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 843 1410 7.0E-101
sp|C3L0B6|IF2_CLOB6 Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 870 1406 7.0E-101
sp|B5XHV3|IF2_STRPZ Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=infB PE=3 SV=1 847 1408 8.0E-101
sp|A2RD01|IF2_STRPG Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=infB PE=3 SV=1 847 1408 8.0E-101
sp|Q609C0|IF2_METCA Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 838 1408 9.0E-101
sp|Q1J5B4|IF2_STRPF Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|B8D7R4|IF2_BUCAT Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=infB PE=3 SV=1 843 1407 1.0E-100
sp|P0DB85|IF2_STRPQ Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q48RU8|IF2_STRPM Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q1JFG4|IF2_STRPD Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q1JKH1|IF2_STRPC Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q1JAC1|IF2_STRPB Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q5XAH1|IF2_STRP6 Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|P0DB84|IF2_STRP3 Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|Q99YG1|IF2_STRP1 Translation initiation factor IF-2 OS=Streptococcus pyogenes serotype M1 GN=infB PE=3 SV=1 847 1408 1.0E-100
sp|B0U1Q8|IF2_XYLFM Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M12) GN=infB PE=3 SV=1 840 1408 1.0E-100
sp|P57458|IF2_BUCAI Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=infB PE=3 SV=1 843 1407 1.0E-100
sp|B8D9G2|IF2_BUCA5 Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=infB PE=3 SV=1 843 1407 1.0E-100
sp|B3QUN2|IF2_CHLT3 Translation initiation factor IF-2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=infB PE=3 SV=1 841 1410 2.0E-100
sp|B1J2A9|IF2_PSEPW Translation initiation factor IF-2 OS=Pseudomonas putida (strain W619) GN=infB PE=3 SV=1 838 1408 2.0E-100
sp|A5CXX6|IF2_VESOH Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 815 1408 2.0E-100
sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 843 1410 2.0E-100
sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 843 1410 2.0E-100
sp|C6E2Q0|IF2_GEOSM Translation initiation factor IF-2 OS=Geobacter sp. (strain M21) GN=infB PE=3 SV=1 841 1408 2.0E-100
sp|Q7MYY7|IF2_PHOLL Translation initiation factor IF-2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=infB PE=3 SV=1 841 1408 2.0E-100
sp|B0S1E5|IF2_FINM2 Translation initiation factor IF-2 OS=Finegoldia magna (strain ATCC 29328) GN=infB PE=3 SV=1 837 1407 2.0E-100
sp|Q2NW23|IF2_SODGM Translation initiation factor IF-2 OS=Sodalis glossinidius (strain morsitans) GN=infB PE=3 SV=1 841 1408 2.0E-100
sp|C3K259|IF2_PSEFS Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain SBW25) GN=infB PE=3 SV=1 838 1408 2.0E-100
sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 841 1408 2.0E-100
sp|Q8R5Z1|IF2_FUSNN Translation initiation factor IF-2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=infB PE=3 SV=1 891 1408 3.0E-100
sp|Q88DV7|IF2_PSEPK Translation initiation factor IF-2 OS=Pseudomonas putida (strain KT2440) GN=infB PE=3 SV=1 838 1408 3.0E-100
sp|Q5M1B9|IF2_STRT1 Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=infB PE=3 SV=1 847 1408 3.0E-100
sp|B8GP02|IF2_THISH Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 838 1408 3.0E-100
sp|Q5M5V5|IF2_STRT2 Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=infB PE=3 SV=1 847 1408 3.0E-100
sp|Q03FS3|IF2_PEDPA Translation initiation factor IF-2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=infB PE=3 SV=1 822 1408 3.0E-100
sp|B5EI57|IF2_GEOBB Translation initiation factor IF-2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=infB PE=3 SV=1 841 1408 4.0E-100
sp|A5W987|IF2_PSEP1 Translation initiation factor IF-2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=infB PE=3 SV=1 838 1408 4.0E-100
sp|B3ELN8|IF2_CHLPB Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain BS1) GN=infB PE=3 SV=1 843 1410 4.0E-100
sp|Q03M88|IF2_STRTD Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=infB PE=3 SV=1 847 1408 4.0E-100
sp|Q5NQ27|IF2_ZYMMO Translation initiation factor IF-2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=infB PE=3 SV=1 840 1407 4.0E-100
sp|B1II49|IF2_CLOBK Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 916 1406 4.0E-100
sp|Q5F797|IF2_NEIG1 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=infB PE=3 SV=1 837 1417 4.0E-100
sp|A7MQE1|IF2_CROS8 Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 841 1408 4.0E-100
sp|B7LR37|IF2_ESCF3 Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|Q48E77|IF2_PSE14 Translation initiation factor IF-2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=infB PE=3 SV=1 838 1408 5.0E-100
sp|A7I3V0|IF2_CAMHC Translation initiation factor IF-2 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=infB PE=3 SV=1 840 1407 5.0E-100
sp|Q83JF9|IF2_SHIFL Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|Q31W47|IF2_SHIBS Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 843 1408 5.0E-100
sp|Q3YX73|IF2_SHISS Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|Q0T0B3|IF2_SHIF8 Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|B0KHX8|IF2_PSEPG Translation initiation factor IF-2 OS=Pseudomonas putida (strain GB-1) GN=infB PE=3 SV=1 838 1408 5.0E-100
sp|B5BGJ5|IF2_SALPK Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|Q5PLB0|IF2_SALPA Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 841 1408 5.0E-100
sp|Q1R6H0|IF2_ECOUT Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B6I1P3|IF2_ECOSE Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7NDF4|IF2_ECOLU Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|P0A705|IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 841 1408 6.0E-100
sp|B1IQV3|IF2_ECOLC Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|P59587|IF2_ECOL6 Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|Q0TCU1|IF2_ECOL5 Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|A1AG73|IF2_ECOK1 Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|A8A4Y4|IF2_ECOHS Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B1XGY0|IF2_ECODH Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|C4ZSQ9|IF2_ECOBW Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7M076|IF2_ECO8A Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7NKN7|IF2_ECO7I Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B5YS58|IF2_ECO5E Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|P0A706|IF2_ECO57 Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7LHN3|IF2_ECO55 Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7MB89|IF2_ECO45 Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7UJ63|IF2_ECO27 Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|A7ZS65|IF2_ECO24 Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B7N0V3|IF2_ECO81 Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|A5FJF9|IF2_FLAJ1 Translation initiation factor IF-2 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|Q32BG5|IF2_SHIDS Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|B2U207|IF2_SHIB3 Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 841 1408 6.0E-100
sp|Q3KI84|IF2_PSEPF Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=infB PE=3 SV=1 838 1408 6.0E-100
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 870 1406 7.0E-100
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 870 1406 7.0E-100
sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|P65134|IF2_STAAN Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 924 1410 7.0E-100
sp|P65133|IF2_STAAM Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 924 1410 7.0E-100
sp|B1LFS0|IF2_ECOSM Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 841 1408 7.0E-100
sp|Q87EV4|IF2_XYLFT Translation initiation factor IF-2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=infB PE=3 SV=1 840 1408 7.0E-100
sp|B2I726|IF2_XYLF2 Translation initiation factor IF-2 OS=Xylella fastidiosa (strain M23) GN=infB PE=3 SV=1 840 1408 7.0E-100
sp|Q4KIF6|IF2_PSEF5 Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=infB PE=3 SV=1 838 1408 8.0E-100
sp|Q8DVP9|IF2_STRMU Translation initiation factor IF-2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=infB PE=3 SV=1 847 1408 8.0E-100
sp|Q1WUF4|IF2_LACS1 Translation initiation factor IF-2 OS=Lactobacillus salivarius (strain UCC118) GN=infB PE=3 SV=1 837 1408 9.0E-100
sp|Q8K9H1|IF2_BUCAP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 849 1407 1.0E-99
sp|B1KWK7|IF2_CLOBM Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 870 1406 1.0E-99
sp|Q1G9P9|IF2_LACDA Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=infB PE=3 SV=1 849 1408 1.0E-99
sp|C1FS59|IF2_CLOBJ Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 870 1406 1.0E-99
sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|A4SGG2|IF2_CHLPM Translation initiation factor IF-2 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=infB PE=3 SV=1 816 1410 1.0E-99
sp|Q57JH9|IF2_SALCH Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 841 1408 1.0E-99
sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 924 1410 1.0E-99
sp|A2SH40|IF2_METPP Translation initiation factor IF-2 OS=Methylibium petroleiphilum (strain PM1) GN=infB PE=3 SV=1 840 1408 1.0E-99
sp|B0SQH4|IF2_LEPBP Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=infB PE=3 SV=1 841 1408 1.0E-99
sp|B0SH18|IF2_LEPBA Translation initiation factor IF-2 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=infB PE=3 SV=1 841 1408 1.0E-99
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 843 1408 1.0E-99
sp|Q049V5|IF2_LACDB Translation initiation factor IF-2 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=infB PE=3 SV=1 849 1408 1.0E-99
sp|A4XYE0|IF2_PSEMY Translation initiation factor IF-2 OS=Pseudomonas mendocina (strain ymp) GN=infB PE=3 SV=1 755 1408 2.0E-99
sp|Q9KA77|IF2_BACHD Translation initiation factor IF-2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=infB PE=3 SV=1 908 1407 2.0E-99
sp|Q6YR66|IF2_ONYPE Translation initiation factor IF-2 OS=Onion yellows phytoplasma (strain OY-M) GN=infB PE=3 SV=1 924 1408 2.0E-99
sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 850 1408 2.0E-99
sp|A6LSQ4|IF2_CLOB8 Translation initiation factor IF-2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=infB PE=3 SV=1 841 1406 2.0E-99
sp|A8AQ58|IF2_CITK8 Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|Q9ZF31|IF2_SALTY Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 841 1408 2.0E-99
sp|C0PZ54|IF2_SALPC Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|A9N732|IF2_SALPB Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B4T6Z8|IF2_SALNS Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B4TJ06|IF2_SALHS Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B5QZV8|IF2_SALEP Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B5FI13|IF2_SALDC Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B5F6T8|IF2_SALA4 Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|Q2G5E7|IF2_NOVAD Translation initiation factor IF-2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=infB PE=3 SV=1 840 1399 2.0E-99
sp|O83861|IF2_TREPA Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B4TWD8|IF2_SALSV Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|B5REN6|IF2_SALG2 Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 841 1408 2.0E-99
sp|Q038M5|IF2_LACC3 Translation initiation factor IF-2 OS=Lactobacillus casei (strain ATCC 334) GN=infB PE=3 SV=1 836 1408 2.0E-99
sp|A9MP36|IF2_SALAR Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 841 1408 3.0E-99
sp|A1TSK3|IF2_ACIAC Translation initiation factor IF-2 OS=Acidovorax citrulli (strain AAC00-1) GN=infB PE=3 SV=1 840 1408 3.0E-99
sp|Q2NC10|IF2_ERYLH Translation initiation factor IF-2 OS=Erythrobacter litoralis (strain HTCC2594) GN=infB PE=3 SV=1 818 1367 4.0E-99
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1578
Ophiocordyceps australis map64 (Brazil) OphauB2|4055
Ophiocordyceps camponoti-floridani Ophcf2|03207
Ophiocordyceps camponoti-rufipedis Ophun1|7198 (this protein)
Ophiocordyceps kimflemingae Ophio5|5701
Ophiocordyceps subramaniannii Hirsu2|8101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7198
MPGAWLSWQLRHQPFICPSCRLRLSSNSISSTRGSTQSIWSGNAPALGRRLSLWGRAAKLPRLISRQSARRLSAS
APLHDDTRKGAVAKTTSFGAFAKRSCGPGAFAKQGAGSPSLGQLGGSLASNAASGSPTSDGLLPHERELRDFMAK
QKAAQFQAPPPVPAAASKPAAQPPTSPHATQRVARPAVKKSNFSRGPSRFELRPANTAVQETSPNPRPASLQAAS
PWEVLSPWTAGRQQPTQSTPTVASGLQSGPDGGRRQQQQQQQQPSPPPPTPKSPTASRQQPDQSTPFAASDLGSR
LDGGQKRQQQQPPTPTQLDTIRQHLVQSKPSTASGLGSRLDEGQKRQQQRQQQQQQQPTPKQPGASRQQPVQSKP
SAASDLGSRLDGGQKRQQQKQQKPPPLASPSWTARGQQPAQSAQFDASHLGSRPDGGQQQKPVQEITPATLPPMP
QATGKQRPAQSSSPAAQAPRRAGAFSNLNVNVPKAQSPEDRYRQQVLQGLNNMSMPQVEQRSQVVAEAVPPERPR
DTKVPVASATQPVSNKPKGAFGGGAFSHFKGDVELSPQMHDNSQIIRRLGWESPTQVPEGVQKSKTPEHPQGLSS
NPAIAFQPAPGKPKRSIGAGAFSHLKADAEQPPQKSDVHQWTHPFGWEAFSPRTQAPTGYSPASAAHSATTNQST
SDQPRWSLRPGAFSHLRNDIEPQPQKSGNDEMTRALGWDALQRKTEAPAEYSEDSVPRPTTPTQPAFDNTGEGFW
KQFEKQASDLRRAEANERRAEERRKDKGPGEKTPESRTKSSSKKKKPRNKRPQLDEDDLDDDIAEKIEMQRRLKA
EKAEMRRLAAEKPPVKTIFIPEFINLHDLAKALRRPINSFLKDLEDMGFENITTDTIMTGETAGLVAAEYEFEAT
VDTGVKKDLRSRPIAEDVSLLPIRPPVVTIMGHVDHGKTTLLDRLRQSSVALQEHGGITQHIGAFVVKMSSGKPI
TFLDTPGHAAFLSMRQRGAYVTDIVVLVVAADDSVMPQTLEALKHAENAKVPIIVAINKVDKPQARVDQVLRDLA
KHNVQLEEFGGDVQAVRVSGKTGEGMDDLVDNIITLSEILDVRAEVDGLAEGWIIESSIKPTGKSATILVKRGTL
RPGDVVVAGKTWARVRLMLDDAGAEVAEAPPGTPVEVLGWRELPPAGELVLQAPDGDKAKMAADYRLEMAERAES
SLQLAEHEQRLRDLAAKKVAEEAAAEEAKKAGLDPAEAAPPTEPAEPGVTYQNLIIRADVIGSVEAVSGLVLELG
NNEVRPRVLRSAAGKVSEFDVDQAAASNAMIISFNQVLLPHIRMRAEAAKVRILEHNVIYSIADDVTTVLEDLLP
LKITHRVLGDLEVQQVFPINIRKRIIRNIAGCRVRNGNVTKTSKVKVLRKAEVLFEGKSDLFVCNLMETLSNATF
LQES*
Coding >Ophun1|7198
ATGCCCGGGGCTTGGCTTTCATGGCAGCTTCGCCACCAGCCCTTCATCTGCCCCTCCTGCCGGCTCAGGCTCTCG
TCCAATTCCATAAGCTCGACACGGGGCTCTACTCAGTCTATATGGAGCGGCAATGCTCCCGCCCTCGGTCGCCGT
CTCTCGCTCTGGGGCCGGGCAGCCAAGCTCCCTCGGCTCATCAGCAGACAGTCTGCTCGTCGGCTATCAGCCTCG
GCGCCGCTCCACGATGACACTAGGAAAGGGGCCGTTGCGAAGACTACATCCTTCGGTGCCTTTGCGAAACGGTCC
TGCGGTCCTGGCGCTTTTGCGAAGCAGGGTGCCGGCTCCCCTTCGCTCGGTCAGCTAGGGGGCTCATTGGCATCC
AATGCCGCGTCTGGCTCGCCGACGTCGGATGGCTTGCTGCCCCACGAGCGAGAATTGCGAGATTTCATGGCGAAG
CAGAAGGCTGCGCAGTTTCAGGCTCCTCCTCCTGTGCCAGCTGCCGCGTCGAAGCCGGCAGCCCAGCCGCCCACT
TCGCCACACGCGACGCAACGGGTTGCGCGTCCGGCGGTCAAGAAGAGCAACTTCAGTCGTGGCCCGTCACGGTTT
GAGCTGCGGCCAGCGAATACTGCAGTGCAAGAAACCAGTCCGAACCCTCGACCGGCATCGCTACAGGCTGCTTCA
CCGTGGGAGGTTCTCTCACCGTGGACGGCTGGCAGGCAACAACCGACTCAGAGCACGCCCACCGTCGCCTCGGGT
CTGCAGTCTGGGCCAGATGGCGGACGGCGGCAGCAGCAACAGCAGCAGCAGCAGCCGTCACCGCCCCCTCCAACC
CCCAAATCACCGACTGCCAGCAGGCAACAGCCGGACCAGAGCACGCCGTTCGCCGCTTCGGACTTGGGATCTCGA
CTAGATGGGGGGCAGAAGCGGCAGCAGCAGCAGCCGCCAACCCCAACACAACTGGATACTATCAGGCAACATCTG
GTGCAGAGCAAGCCGTCCACCGCTTCGGGCCTGGGATCTCGACTAGATGAGGGGCAGAAGCGGCAGCAGCAGAGA
CAGCAGCAGCAGCAGCAGCAGCCAACTCCCAAACAACCGGGTGCCAGCAGGCAACAACCGGTCCAGAGCAAGCCG
TCCGCCGCTTCGGACTTGGGATCTCGACTAGATGGGGGGCAGAAGCGGCAGCAACAGAAACAGCAGAAGCCGCCG
CCACTGGCTTCCCCATCATGGACGGCTCGTGGGCAGCAACCGGCCCAGAGCGCACAGTTCGACGCTTCGCACCTG
GGATCTCGACCAGATGGCGGGCAGCAGCAGAAGCCGGTCCAGGAAATAACACCTGCTACCCTACCTCCTATGCCT
CAAGCGACTGGCAAACAGCGACCGGCTCAGAGCTCCTCACCCGCTGCTCAGGCGCCCCGCAGAGCCGGCGCCTTC
AGCAATCTCAATGTGAACGTTCCAAAAGCACAGAGTCCAGAGGACAGATATCGGCAACAGGTACTTCAGGGTCTG
AATAATATGTCAATGCCTCAGGTCGAGCAGAGATCTCAGGTGGTTGCCGAAGCGGTGCCTCCAGAGCGACCACGA
GACACCAAGGTCCCTGTAGCAAGTGCCACTCAACCGGTCTCTAACAAACCCAAAGGTGCTTTCGGAGGCGGCGCC
TTTAGCCACTTCAAAGGAGACGTTGAACTGTCACCACAGATGCACGACAACAGCCAGATAATTCGACGTCTCGGA
TGGGAGTCCCCCACGCAGGTTCCCGAAGGTGTCCAGAAGTCCAAGACTCCAGAGCATCCACAAGGGTTGAGTTCA
AATCCGGCTATTGCTTTTCAGCCAGCTCCTGGTAAACCAAAGCGGAGCATCGGAGCCGGCGCCTTTAGCCATCTC
AAAGCAGACGCTGAACAGCCTCCCCAAAAGTCCGACGTCCATCAGTGGACTCATCCTTTTGGATGGGAGGCCTTT
TCACCAAGAACGCAAGCTCCTACTGGATATTCTCCGGCATCCGCGGCGCATTCGGCCACTACCAACCAGTCAACT
TCTGATCAACCCAGGTGGTCCCTCAGACCCGGCGCTTTCAGCCATCTCCGAAACGACATAGAACCGCAGCCGCAA
AAGTCCGGCAACGACGAAATGACTCGAGCTCTCGGATGGGATGCCCTCCAACGCAAAACGGAAGCTCCTGCAGAA
TATTCAGAAGACTCCGTGCCGCGTCCGACGACTCCCACGCAGCCGGCTTTCGACAACACCGGGGAAGGCTTTTGG
AAGCAGTTCGAGAAGCAGGCGTCGGACTTGCGACGCGCAGAAGCGAATGAACGTCGGGCAGAGGAGCGACGCAAA
GACAAAGGCCCCGGAGAGAAAACTCCCGAGTCAAGGACCAAATCCAGCTCCAAGAAGAAGAAACCTCGCAACAAG
CGCCCGCAGTTGGATGAGGATGACCTGGATGATGACATCGCCGAAAAGATCGAGATGCAGCGGAGGCTCAAAGCT
GAGAAGGCGGAAATGAGACGGTTGGCTGCTGAAAAGCCGCCAGTGAAAACCATCTTCATCCCAGAGTTCATCAAT
CTGCATGACCTGGCCAAGGCCTTGAGAAGACCTATCAACAGTTTTCTCAAAGATCTGGAGGACATGGGCTTCGAG
AACATCACGACTGACACCATCATGACGGGCGAGACGGCTGGGCTCGTTGCGGCCGAGTACGAGTTTGAGGCAACG
GTCGACACGGGCGTCAAGAAGGATCTGAGGAGTCGGCCGATTGCGGAAGACGTCTCCCTCCTCCCGATCCGTCCT
CCCGTCGTCACCATCATGGGCCACGTCGATCACGGCAAGACAACGCTGCTGGACCGGTTGAGGCAGTCGTCGGTG
GCGCTTCAGGAGCACGGCGGTATCACGCAGCACATCGGCGCCTTTGTCGTCAAGATGTCGTCGGGCAAGCCCATT
ACCTTTCTCGACACGCCTGGACACGCCGCCTTCCTGTCGATGCGTCAGCGTGGCGCCTACGTGACCGACATCGTC
GTGCTGGTCGTAGCCGCAGACGACAGCGTGATGCCGCAGACGCTCGAGGCGCTGAAGCACGCCGAGAACGCCAAG
GTACCCATCATCGTTGCCATCAACAAGGTCGATAAGCCCCAGGCTCGCGTCGACCAGGTGTTGCGCGACCTTGCC
AAGCACAACGTCCAGCTCGAGGAGTTTGGAGGCGACGTACAGGCAGTGCGCGTCAGCGGCAAGACGGGCGAGGGT
ATGGACGACCTGGTAGACAACATCATCACCCTGTCCGAGATTCTCGACGTCCGCGCTGAAGTGGACGGTTTGGCC
GAGGGCTGGATCATCGAGTCAAGCATCAAGCCGACGGGCAAGTCGGCCACCATCCTGGTCAAGCGGGGGACGTTG
CGACCCGGCGATGTGGTCGTGGCCGGCAAGACCTGGGCCCGGGTCCGACTTATGCTGGACGACGCCGGCGCAGAG
GTGGCCGAGGCGCCACCGGGGACGCCCGTCGAGGTGCTGGGCTGGCGAGAGTTGCCACCGGCGGGCGAGCTGGTG
CTGCAGGCCCCAGACGGGGACAAGGCCAAGATGGCAGCCGATTACCGGTTGGAGATGGCCGAACGGGCCGAGAGC
TCTCTGCAGCTGGCCGAGCACGAGCAGCGGCTTCGGGATCTGGCGGCCAAGAAGGTGGCCGAAGAGGCGGCCGCG
GAAGAAGCCAAGAAGGCAGGCCTTGATCCAGCCGAGGCGGCACCTCCCACGGAACCTGCGGAGCCGGGCGTCACG
TACCAAAACCTCATCATCCGGGCCGACGTCATCGGCTCGGTAGAGGCCGTTTCTGGCCTCGTGCTCGAGCTCGGC
AACAACGAAGTGCGGCCAAGGGTGCTACGCTCGGCGGCAGGCAAGGTCTCGGAGTTCGACGTCGACCAGGCGGCC
GCGTCCAACGCCATGATCATCAGCTTCAATCAGGTGCTGCTCCCGCATATCCGGATGCGGGCCGAAGCGGCCAAG
GTGCGCATTCTCGAGCACAACGTCATCTACAGCATCGCCGACGACGTGACGACCGTGCTGGAGGACCTGCTGCCA
CTCAAGATAACGCACCGCGTTCTGGGCGACCTTGAAGTGCAGCAGGTGTTCCCCATCAATATCAGGAAGCGCATC
ATACGCAATATTGCGGGCTGCAGGGTTCGCAATGGGAACGTGACGAAGACTTCCAAGGTGAAGGTGCTGCGCAAG
GCCGAGGTTCTCTTCGAGGGTAAGTCTGATCTCTTTGTCTGTAATCTCATGGAGACTCTTTCTAACGCAACCTTT
CTGCAGGAGTCGTAA
Transcript >Ophun1|7198
ATGCCCGGGGCTTGGCTTTCATGGCAGCTTCGCCACCAGCCCTTCATCTGCCCCTCCTGCCGGCTCAGGCTCTCG
TCCAATTCCATAAGCTCGACACGGGGCTCTACTCAGTCTATATGGAGCGGCAATGCTCCCGCCCTCGGTCGCCGT
CTCTCGCTCTGGGGCCGGGCAGCCAAGCTCCCTCGGCTCATCAGCAGACAGTCTGCTCGTCGGCTATCAGCCTCG
GCGCCGCTCCACGATGACACTAGGAAAGGGGCCGTTGCGAAGACTACATCCTTCGGTGCCTTTGCGAAACGGTCC
TGCGGTCCTGGCGCTTTTGCGAAGCAGGGTGCCGGCTCCCCTTCGCTCGGTCAGCTAGGGGGCTCATTGGCATCC
AATGCCGCGTCTGGCTCGCCGACGTCGGATGGCTTGCTGCCCCACGAGCGAGAATTGCGAGATTTCATGGCGAAG
CAGAAGGCTGCGCAGTTTCAGGCTCCTCCTCCTGTGCCAGCTGCCGCGTCGAAGCCGGCAGCCCAGCCGCCCACT
TCGCCACACGCGACGCAACGGGTTGCGCGTCCGGCGGTCAAGAAGAGCAACTTCAGTCGTGGCCCGTCACGGTTT
GAGCTGCGGCCAGCGAATACTGCAGTGCAAGAAACCAGTCCGAACCCTCGACCGGCATCGCTACAGGCTGCTTCA
CCGTGGGAGGTTCTCTCACCGTGGACGGCTGGCAGGCAACAACCGACTCAGAGCACGCCCACCGTCGCCTCGGGT
CTGCAGTCTGGGCCAGATGGCGGACGGCGGCAGCAGCAACAGCAGCAGCAGCAGCCGTCACCGCCCCCTCCAACC
CCCAAATCACCGACTGCCAGCAGGCAACAGCCGGACCAGAGCACGCCGTTCGCCGCTTCGGACTTGGGATCTCGA
CTAGATGGGGGGCAGAAGCGGCAGCAGCAGCAGCCGCCAACCCCAACACAACTGGATACTATCAGGCAACATCTG
GTGCAGAGCAAGCCGTCCACCGCTTCGGGCCTGGGATCTCGACTAGATGAGGGGCAGAAGCGGCAGCAGCAGAGA
CAGCAGCAGCAGCAGCAGCAGCCAACTCCCAAACAACCGGGTGCCAGCAGGCAACAACCGGTCCAGAGCAAGCCG
TCCGCCGCTTCGGACTTGGGATCTCGACTAGATGGGGGGCAGAAGCGGCAGCAACAGAAACAGCAGAAGCCGCCG
CCACTGGCTTCCCCATCATGGACGGCTCGTGGGCAGCAACCGGCCCAGAGCGCACAGTTCGACGCTTCGCACCTG
GGATCTCGACCAGATGGCGGGCAGCAGCAGAAGCCGGTCCAGGAAATAACACCTGCTACCCTACCTCCTATGCCT
CAAGCGACTGGCAAACAGCGACCGGCTCAGAGCTCCTCACCCGCTGCTCAGGCGCCCCGCAGAGCCGGCGCCTTC
AGCAATCTCAATGTGAACGTTCCAAAAGCACAGAGTCCAGAGGACAGATATCGGCAACAGGTACTTCAGGGTCTG
AATAATATGTCAATGCCTCAGGTCGAGCAGAGATCTCAGGTGGTTGCCGAAGCGGTGCCTCCAGAGCGACCACGA
GACACCAAGGTCCCTGTAGCAAGTGCCACTCAACCGGTCTCTAACAAACCCAAAGGTGCTTTCGGAGGCGGCGCC
TTTAGCCACTTCAAAGGAGACGTTGAACTGTCACCACAGATGCACGACAACAGCCAGATAATTCGACGTCTCGGA
TGGGAGTCCCCCACGCAGGTTCCCGAAGGTGTCCAGAAGTCCAAGACTCCAGAGCATCCACAAGGGTTGAGTTCA
AATCCGGCTATTGCTTTTCAGCCAGCTCCTGGTAAACCAAAGCGGAGCATCGGAGCCGGCGCCTTTAGCCATCTC
AAAGCAGACGCTGAACAGCCTCCCCAAAAGTCCGACGTCCATCAGTGGACTCATCCTTTTGGATGGGAGGCCTTT
TCACCAAGAACGCAAGCTCCTACTGGATATTCTCCGGCATCCGCGGCGCATTCGGCCACTACCAACCAGTCAACT
TCTGATCAACCCAGGTGGTCCCTCAGACCCGGCGCTTTCAGCCATCTCCGAAACGACATAGAACCGCAGCCGCAA
AAGTCCGGCAACGACGAAATGACTCGAGCTCTCGGATGGGATGCCCTCCAACGCAAAACGGAAGCTCCTGCAGAA
TATTCAGAAGACTCCGTGCCGCGTCCGACGACTCCCACGCAGCCGGCTTTCGACAACACCGGGGAAGGCTTTTGG
AAGCAGTTCGAGAAGCAGGCGTCGGACTTGCGACGCGCAGAAGCGAATGAACGTCGGGCAGAGGAGCGACGCAAA
GACAAAGGCCCCGGAGAGAAAACTCCCGAGTCAAGGACCAAATCCAGCTCCAAGAAGAAGAAACCTCGCAACAAG
CGCCCGCAGTTGGATGAGGATGACCTGGATGATGACATCGCCGAAAAGATCGAGATGCAGCGGAGGCTCAAAGCT
GAGAAGGCGGAAATGAGACGGTTGGCTGCTGAAAAGCCGCCAGTGAAAACCATCTTCATCCCAGAGTTCATCAAT
CTGCATGACCTGGCCAAGGCCTTGAGAAGACCTATCAACAGTTTTCTCAAAGATCTGGAGGACATGGGCTTCGAG
AACATCACGACTGACACCATCATGACGGGCGAGACGGCTGGGCTCGTTGCGGCCGAGTACGAGTTTGAGGCAACG
GTCGACACGGGCGTCAAGAAGGATCTGAGGAGTCGGCCGATTGCGGAAGACGTCTCCCTCCTCCCGATCCGTCCT
CCCGTCGTCACCATCATGGGCCACGTCGATCACGGCAAGACAACGCTGCTGGACCGGTTGAGGCAGTCGTCGGTG
GCGCTTCAGGAGCACGGCGGTATCACGCAGCACATCGGCGCCTTTGTCGTCAAGATGTCGTCGGGCAAGCCCATT
ACCTTTCTCGACACGCCTGGACACGCCGCCTTCCTGTCGATGCGTCAGCGTGGCGCCTACGTGACCGACATCGTC
GTGCTGGTCGTAGCCGCAGACGACAGCGTGATGCCGCAGACGCTCGAGGCGCTGAAGCACGCCGAGAACGCCAAG
GTACCCATCATCGTTGCCATCAACAAGGTCGATAAGCCCCAGGCTCGCGTCGACCAGGTGTTGCGCGACCTTGCC
AAGCACAACGTCCAGCTCGAGGAGTTTGGAGGCGACGTACAGGCAGTGCGCGTCAGCGGCAAGACGGGCGAGGGT
ATGGACGACCTGGTAGACAACATCATCACCCTGTCCGAGATTCTCGACGTCCGCGCTGAAGTGGACGGTTTGGCC
GAGGGCTGGATCATCGAGTCAAGCATCAAGCCGACGGGCAAGTCGGCCACCATCCTGGTCAAGCGGGGGACGTTG
CGACCCGGCGATGTGGTCGTGGCCGGCAAGACCTGGGCCCGGGTCCGACTTATGCTGGACGACGCCGGCGCAGAG
GTGGCCGAGGCGCCACCGGGGACGCCCGTCGAGGTGCTGGGCTGGCGAGAGTTGCCACCGGCGGGCGAGCTGGTG
CTGCAGGCCCCAGACGGGGACAAGGCCAAGATGGCAGCCGATTACCGGTTGGAGATGGCCGAACGGGCCGAGAGC
TCTCTGCAGCTGGCCGAGCACGAGCAGCGGCTTCGGGATCTGGCGGCCAAGAAGGTGGCCGAAGAGGCGGCCGCG
GAAGAAGCCAAGAAGGCAGGCCTTGATCCAGCCGAGGCGGCACCTCCCACGGAACCTGCGGAGCCGGGCGTCACG
TACCAAAACCTCATCATCCGGGCCGACGTCATCGGCTCGGTAGAGGCCGTTTCTGGCCTCGTGCTCGAGCTCGGC
AACAACGAAGTGCGGCCAAGGGTGCTACGCTCGGCGGCAGGCAAGGTCTCGGAGTTCGACGTCGACCAGGCGGCC
GCGTCCAACGCCATGATCATCAGCTTCAATCAGGTGCTGCTCCCGCATATCCGGATGCGGGCCGAAGCGGCCAAG
GTGCGCATTCTCGAGCACAACGTCATCTACAGCATCGCCGACGACGTGACGACCGTGCTGGAGGACCTGCTGCCA
CTCAAGATAACGCACCGCGTTCTGGGCGACCTTGAAGTGCAGCAGGTGTTCCCCATCAATATCAGGAAGCGCATC
ATACGCAATATTGCGGGCTGCAGGGTTCGCAATGGGAACGTGACGAAGACTTCCAAGGTGAAGGTGCTGCGCAAG
GCCGAGGTTCTCTTCGAGGGTAAGTCTGATCTCTTTGTCTGTAATCTCATGGAGACTCTTTCTAACGCAACCTTT
CTGCAGGAGTCGTAA
Gene >Ophun1|7198
ATGCCCGGGGCTTGGCTTTCATGGCAGGTAGGCAGGCTGTGGTTGCGACTGGACACATCCCGTCTGACCAAGGAT
TCCGATAGCTTCGCCACCAGCCCTTCATCTGCCCCTCCTGCCGGCTCAGGCTCTCGTCCAATTCCATAAGCTCGA
CACGGGGCTCTACTCAGTCTATATGGAGCGGCAATGCTCCCGCCCTCGGTCGCCGTCTCTCGCTCTGGGGCCGGG
CAGCCAAGCTCCCTCGGCTCATCAGCAGACAGTCTGCTCGTCGGCTATCAGCCTCGGCGCCGCTCCACGATGACA
CTAGGAAAGGGGCCGTTGCGAAGACTACATCCTTCGGTGCCTTTGCGAAACGGTCCTGCGGTCCTGGCGCTTTTG
CGAAGCAGGGTGCCGGCTCCCCTTCGCTCGGTCAGCTAGGGGGCTCATTGGCATCCAATGCCGCGTCTGGCTCGC
CGACGTCGGATGGCTTGCTGCCCCACGAGCGAGAATTGCGAGATTTCATGGCGAAGCAGAAGGCTGCGCAGTTTC
AGGCTCCTCCTCCTGTGCCAGCTGCCGCGTCGAAGCCGGCAGCCCAGCCGCCCACTTCGCCACACGCGACGCAAC
GGGTTGCGCGTCCGGCGGTCAAGAAGAGCAACTTCAGTCGTGGCCCGTCACGGTTTGAGCTGCGGCCAGCGAATA
CTGCAGTGCAAGAAACCAGTCCGAACCCTCGACCGGCATCGCTACAGGCTGCTTCACCGTGGGAGGTTCTCTCAC
CGTGGACGGCTGGCAGGCAACAACCGACTCAGAGCACGCCCACCGTCGCCTCGGGTCTGCAGTCTGGGCCAGATG
GCGGACGGCGGCAGCAGCAACAGCAGCAGCAGCAGCCGTCACCGCCCCCTCCAACCCCCAAATCACCGACTGCCA
GCAGGCAACAGCCGGACCAGAGCACGCCGTTCGCCGCTTCGGACTTGGGATCTCGACTAGATGGGGGGCAGAAGC
GGCAGCAGCAGCAGCCGCCAACCCCAACACAACTGGATACTATCAGGCAACATCTGGTGCAGAGCAAGCCGTCCA
CCGCTTCGGGCCTGGGATCTCGACTAGATGAGGGGCAGAAGCGGCAGCAGCAGAGACAGCAGCAGCAGCAGCAGC
AGCCAACTCCCAAACAACCGGGTGCCAGCAGGCAACAACCGGTCCAGAGCAAGCCGTCCGCCGCTTCGGACTTGG
GATCTCGACTAGATGGGGGGCAGAAGCGGCAGCAACAGAAACAGCAGAAGCCGCCGCCACTGGCTTCCCCATCAT
GGACGGCTCGTGGGCAGCAACCGGCCCAGAGCGCACAGTTCGACGCTTCGCACCTGGGATCTCGACCAGATGGCG
GGCAGCAGCAGAAGCCGGTCCAGGAAATAACACCTGCTACCCTACCTCCTATGCCTCAAGCGACTGGCAAACAGC
GACCGGCTCAGAGCTCCTCACCCGCTGCTCAGGCGCCCCGCAGAGCCGGCGCCTTCAGCAATCTCAATGTGAACG
TTCCAAAAGCACAGAGTCCAGAGGACAGATATCGGCAACAGGTACTTCAGGGTCTGAATAATATGTCAATGCCTC
AGGTCGAGCAGAGATCTCAGGTGGTTGCCGAAGCGGTGCCTCCAGAGCGACCACGAGACACCAAGGTCCCTGTAG
CAAGTGCCACTCAACCGGTCTCTAACAAACCCAAAGGTGCTTTCGGAGGCGGCGCCTTTAGCCACTTCAAAGGAG
ACGTTGAACTGTCACCACAGATGCACGACAACAGCCAGATAATTCGACGTCTCGGATGGGAGTCCCCCACGCAGG
TTCCCGAAGGTGTCCAGAAGTCCAAGACTCCAGAGCATCCACAAGGGTTGAGTTCAAATCCGGCTATTGCTTTTC
AGCCAGCTCCTGGTAAACCAAAGCGGAGCATCGGAGCCGGCGCCTTTAGCCATCTCAAAGCAGACGCTGAACAGC
CTCCCCAAAAGTCCGACGTCCATCAGTGGACTCATCCTTTTGGATGGGAGGCCTTTTCACCAAGAACGCAAGCTC
CTACTGGATATTCTCCGGCATCCGCGGCGCATTCGGCCACTACCAACCAGTCAACTTCTGATCAACCCAGGTGGT
CCCTCAGACCCGGCGCTTTCAGCCATCTCCGAAACGACATAGAACCGCAGCCGCAAAAGTCCGGCAACGACGAAA
TGACTCGAGCTCTCGGATGGGATGCCCTCCAACGCAAAACGGAAGCTCCTGCAGAATATTCAGAAGACTCCGTGC
CGCGTCCGACGACTCCCACGCAGCCGGCTTTCGACAACACCGGGGAAGGCTTTTGGAAGCAGTTCGAGAAGCAGG
CGTCGGACTTGCGACGCGCAGAAGCGAATGAACGTCGGGCAGAGGAGCGACGCAAAGACAAAGGCCCCGGAGAGA
AAACTCCCGAGTCAAGGACCAAATCCAGCTCCAAGAAGAAGAAACCTCGCAACAAGCGCCCGCAGTTGGATGAGG
ATGACCTGGATGATGACATCGCCGAAAAGATCGAGATGCAGCGGAGGCTCAAAGCTGAGAAGGCGGAAATGAGAC
GGTTGGCTGCTGAAAAGCCGCCAGTGAAAACCATCTTCATCCCAGAGTTCATCAATCTGCATGACCTGGCCAAGG
CCTTGAGAAGACCTATCAACAGTTTTCTCAAAGATCTGGAGGACATGGGCTTCGAGAACATCACGACTGACACCA
TCATGACGGGCGAGACGGCTGGGCTCGTTGCGGCCGAGTACGAGTTTGAGGCAACGGTCGACACGGGCGTCAAGA
AGGATCTGAGGAGTCGGCCGATTGCGGAAGACGTCTCCCTCCTCCCGATCCGTCCTCCCGTCGTCACCATCATGG
GCCACGTCGATCACGGCAAGACAACGCTGCTGGACCGGTTGAGGCAGTCGTCGGTGGCGCTTCAGGAGCACGGCG
GTATCACGCAGCACATCGGCGCCTTTGTCGTCAAGATGTCGTCGGGCAAGCCCATTACCTTTCTCGACACGCCTG
GACACGCCGCCTTCCTGTCGATGCGTCAGCGTGGCGCCTACGTGACCGACATCGTCGTGCTGGTCGTAGCCGCAG
ACGACAGCGTGATGCCGCAGACGCTCGAGGCGCTGAAGCACGCCGAGAACGCCAAGGTACCCATCATCGTTGCCA
TCAACAAGGTCGATAAGCCCCAGGCTCGCGTCGACCAGGTGTTGCGCGACCTTGCCAAGCACAACGTCCAGCTCG
AGGAGTTTGGAGGCGACGTACAGGCAGTGCGCGTCAGCGGCAAGACGGGCGAGGGTATGGACGACCTGGTAGACA
ACATCATCACCCTGTCCGAGATTCTCGACGTCCGCGCTGAAGTGGACGGTTTGGCCGAGGGCTGGATCATCGAGT
CAAGCATCAAGCCGACGGGCAAGTCGGCCACCATCCTGGTCAAGCGGGGGACGTTGCGACCCGGCGATGTGGTCG
TGGCCGGCAAGACCTGGGCCCGGGTCCGACTTATGCTGGACGACGCCGGCGCAGAGGTGGCCGAGGCGCCACCGG
GGACGCCCGTCGAGGTGCTGGGCTGGCGAGAGTTGCCACCGGCGGGCGAGCTGGTGCTGCAGGCCCCAGACGGGG
ACAAGGCCAAGATGGCAGCCGATTACCGGTTGGAGATGGCCGAACGGGCCGAGAGCTCTCTGCAGCTGGCCGAGC
ACGAGCAGCGGCTTCGGGATCTGGCGGCCAAGAAGGTGGCCGAAGAGGCGGCCGCGGAAGAAGCCAAGAAGGCAG
GCCTTGATCCAGCCGAGGCGGCACCTCCCACGGAACCTGCGGAGCCGGGCGTCACGTACCAAAACCTCATCATCC
GGGCCGACGTCATCGGCTCGGTAGAGGCCGTTTCTGGCCTCGTGCTCGAGCTCGGCAACAACGAAGTGCGGCCAA
GGGTGCTACGCTCGGCGGCAGGCAAGGTCTCGGAGTTCGACGTCGACCAGGCGGCCGCGTCCAACGCCATGATCA
TCAGCTTCAATCAGGTGCTGCTCCCGCATATCCGGATGCGGGCCGAAGCGGCCAAGGTGCGCATTCTCGAGCACA
ACGTCATCTACAGCATCGCCGACGACGTGACGACCGTGCTGGAGGACCTGCTGCCACTCAAGATAACGCACCGCG
TTCTGGGCGACCTTGAAGTGCAGCAGGTGTTCCCCATCAATATCAGGAAGCGCATCATACGCAATATTGCGGGCT
GCAGGGTTCGCAATGGGAACGTGACGAAGACTTCCAAGGTGAAGGTGCTGCGCAAGGCCGAGGTTCTCTTCGAGG
GTAAGTCTGATCTCTTTGTCTGTAATCTCATGGAGACTCTTTCTAACGCAACCTTTCTGCAGGAGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail