Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7196
Gene name
LocationContig_870:4614..5565
Strand-
Gene length (bp)951
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18121 TFA2_Winged_2 TFA2 Winged helix domain 2 3.6E-20 172 232
PF02186 TFIIE_beta TFIIE beta subunit core domain 4.1E-13 95 167

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P79011|T2EB_SCHPO Transcription initiation factor IIE subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfa2 PE=1 SV=2 48 315 5.0E-38
sp|P36145|T2EB_YEAST Transcription initiation factor IIE subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFA2 PE=1 SV=3 96 312 3.0E-35

GO

GO Term Description Terminal node
GO:0006367 transcription initiation from RNA polymerase II promoter Yes
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006352 DNA-templated transcription, initiation No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3232
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3009
Ophiocordyceps australis map64 (Brazil) OphauB2|484
Ophiocordyceps camponoti-floridani Ophcf2|01236
Ophiocordyceps camponoti-rufipedis Ophun1|7196 (this protein)
Ophiocordyceps kimflemingae Ophio5|5042
Ophiocordyceps subramaniannii Hirsu2|584

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7196
MSSYLEKQSSAFRGTLASAASKLSNAKTTGGGVKAVVAAAAAASSLAPPSPSPSAASDSATPTTTTTTTGKRKRE
AGPDVPFSQPQLTGYGAEVKTQMTFAVEYLKKKGEAKTMTDIIDHLSLRAYSDQHKRELAEGLRGHPRVDWRPDT
SLAEQSWRTGTYSHRPIIPGVRDATSLLAFLQRKTDASGVSVKDLKDGWPDCEETLSSLESQNKVLVVRTKKDNF
PRYVWPDDASLKHKVQPEFQSRWHHVPLPSLEDMHRKLVSVGQKPTSDDPRKAVQGAVKPKVQKKKAGKKVGKAT
NVHMQHLMLDYSGMRR*
Coding >Ophun1|7196
ATGTCGTCATATCTGGAGAAGCAGTCGTCAGCCTTCCGCGGCACGCTCGCCTCAGCCGCGTCGAAGCTCTCCAAC
GCCAAAACCACAGGCGGCGGCGTAAAAGCCGTGGTAGCAGCCGCCGCCGCCGCATCATCCCTGGCGCCACCCTCG
CCGTCCCCCTCAGCGGCATCAGACAGCGCCACGCCCACGACGACGACGACGACGACGGGGAAGCGCAAGCGCGAG
GCTGGACCGGATGTTCCCTTCTCGCAGCCTCAGCTCACGGGCTATGGAGCAGAGGTCAAGACGCAGATGACTTTT
GCCGTCGAGTACCTCAAGAAGAAAGGCGAGGCCAAGACCATGACGGATATCATCGATCATCTTAGCTTGCGCGCC
TACTCGGATCAGCATAAGCGTGAGCTGGCCGAGGGCTTGAGGGGACACCCGCGCGTGGATTGGAGGCCTGATACC
TCGCTGGCGGAACAATCCTGGCGGACGGGCACCTACAGTCACCGTCCCATCATCCCCGGCGTCCGCGACGCAACC
TCCCTCCTCGCCTTCCTCCAACGCAAGACGGACGCGTCAGGCGTATCAGTAAAAGACCTAAAAGACGGCTGGCCC
GACTGCGAAGAAACGCTCTCGTCCCTAGAAAGCCAAAACAAAGTCCTCGTCGTGCGCACGAAAAAGGACAACTTC
CCCCGCTACGTCTGGCCCGACGACGCCTCCCTCAAGCACAAGGTCCAGCCCGAGTTCCAATCGCGATGGCATCAC
GTCCCGCTGCCCAGCCTCGAAGACATGCACCGCAAGCTCGTCTCCGTCGGACAGAAGCCCACGAGCGATGACCCG
CGCAAGGCCGTTCAGGGCGCCGTCAAGCCAAAGGTGCAGAAGAAGAAGGCGGGGAAGAAGGTGGGCAAGGCGACC
AATGTTCATATGCAGCACTTGATGCTGGATTATAGCGGGATGCGGAGGTGA
Transcript >Ophun1|7196
ATGTCGTCATATCTGGAGAAGCAGTCGTCAGCCTTCCGCGGCACGCTCGCCTCAGCCGCGTCGAAGCTCTCCAAC
GCCAAAACCACAGGCGGCGGCGTAAAAGCCGTGGTAGCAGCCGCCGCCGCCGCATCATCCCTGGCGCCACCCTCG
CCGTCCCCCTCAGCGGCATCAGACAGCGCCACGCCCACGACGACGACGACGACGACGGGGAAGCGCAAGCGCGAG
GCTGGACCGGATGTTCCCTTCTCGCAGCCTCAGCTCACGGGCTATGGAGCAGAGGTCAAGACGCAGATGACTTTT
GCCGTCGAGTACCTCAAGAAGAAAGGCGAGGCCAAGACCATGACGGATATCATCGATCATCTTAGCTTGCGCGCC
TACTCGGATCAGCATAAGCGTGAGCTGGCCGAGGGCTTGAGGGGACACCCGCGCGTGGATTGGAGGCCTGATACC
TCGCTGGCGGAACAATCCTGGCGGACGGGCACCTACAGTCACCGTCCCATCATCCCCGGCGTCCGCGACGCAACC
TCCCTCCTCGCCTTCCTCCAACGCAAGACGGACGCGTCAGGCGTATCAGTAAAAGACCTAAAAGACGGCTGGCCC
GACTGCGAAGAAACGCTCTCGTCCCTAGAAAGCCAAAACAAAGTCCTCGTCGTGCGCACGAAAAAGGACAACTTC
CCCCGCTACGTCTGGCCCGACGACGCCTCCCTCAAGCACAAGGTCCAGCCCGAGTTCCAATCGCGATGGCATCAC
GTCCCGCTGCCCAGCCTCGAAGACATGCACCGCAAGCTCGTCTCCGTCGGACAGAAGCCCACGAGCGATGACCCG
CGCAAGGCCGTTCAGGGCGCCGTCAAGCCAAAGGTGCAGAAGAAGAAGGCGGGGAAGAAGGTGGGCAAGGCGACC
AATGTTCATATGCAGCACTTGATGCTGGATTATAGCGGGATGCGGAGGTGA
Gene >Ophun1|7196
ATGTCGTCATATCTGGAGAAGCAGTCGTCAGCCTTCCGCGGCACGCTCGCCTCAGCCGCGTCGAAGCTCTCCAAC
GCCAAAACCACAGGCGGCGGCGTAAAAGCCGTGGTAGCAGCCGCCGCCGCCGCATCATCCCTGGCGCCACCCTCG
CCGTCCCCCTCAGCGGCATCAGACAGCGCCACGCCCACGACGACGACGACGACGACGGGGAAGCGCAAGCGCGAG
GCTGGACCGGATGTTCCCTTCTCGCAGCCTCAGCTCACGGGCTATGGAGCAGAGGTCAAGACGCAGATGACTTTT
GCCGTCGAGTACCTCAAGAAGAAAGGCGAGGCCAAGACCATGACGGATATCATCGATCATCTTAGCTTGCGCGCC
TACTCGGATCAGCATAAGCGTGAGCTGGCCGAGGGCTTGAGGGGACACCCGCGCGTGGATTGGAGGCCTGATACC
TCGCTGGCGGAACAATCCTGGCGGACGGGCACCTACAGTCACCGTCCCATCATCCCCGGCGTCCGCGACGCAACC
TCCCTCCTCGCCTTCCTCCAACGCAAGACGGACGCGTCAGGCGTATCAGTAAAAGACCTAAAAGACGGCTGGCCC
GACTGCGAAGAAACGCTCTCGTCCCTAGAAAGCCAAAACAAAGTCCTCGTCGTGCGCACGAAAAAGGACAACTTC
CCCCGCTACGTCTGGCCCGACGACGCCTCCCTCAAGCACAAGGTCCAGCCCGAGTTCCAATCGCGATGGCATCAC
GTCCCGCTGCCCAGCCTCGAAGACATGCACCGCAAGCTCGTCTCCGTCGGACAGAAGCCCACGAGCGATGACCCG
CGCAAGGCCGTTCAGGGCGCCGTCAAGCCAAAGGTGCAGAAGAAGAAGGCGGGGAAGAAGGTGGGCAAGGCGACC
AATGTTCATATGCAGCACTTGATGCTGGATTATAGCGGGATGCGGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail