Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7194
Gene name
LocationContig_87:39856..40574
Strand-
Gene length (bp)718
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00156 Pribosyltran Phosphoribosyl transferase domain 2.1E-06 15 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47165|XPT1_YEAST Xanthine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XPT1 PE=1 SV=1 2 199 8.0E-74
sp|O13917|HPRT_SCHPO Hypoxanthine-guanine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hpt1 PE=3 SV=1 4 195 1.0E-59
sp|Q04178|HPRT_YEAST Hypoxanthine-guanine phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HPT1 PE=1 SV=1 2 197 7.0E-58

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7194
MDEKIYVTYNDVHKLCQKSAVRLLADFKPQLMIAIGGGGYVPARILRSFLKQPDSPNIPIQAIGLSLYESLGGTE
VEAIGKKVTRTQWLDLTALGEMENLVGKRVLIVDEVDDTRTTLEYAVKELEKDIEAARQRMGGDLPKTQFCIFVL
HNKDKPKKGTLPDDMLATRYEAAETVQDVWINYPWEAIDIDEHDGLARAAKGT*
Coding >Ophun1|7194
ATGGATGAAAAAATTTACGTCACGTACAACGATGTCCACAAGCTCTGCCAAAAGTCGGCCGTCCGCCTTCTAGCC
GATTTCAAGCCCCAGCTCATGATTGCCATCGGCGGAGGCGGCTACGTGCCTGCCCGCATCTTGCGCTCCTTTCTC
AAGCAGCCCGACTCGCCCAACATCCCCATCCAGGCCATCGGGCTCTCGCTCTACGAGTCCCTCGGCGGAACCGAG
GTCGAGGCTATCGGCAAAAAGGTCACCCGCACCCAATGGCTCGACCTCACTGCTCTAGGCGAGATGGAGAACCTG
GTCGGCAAGCGCGTCCTCATCGTCGACGAGGTTGACGACACCCGGACTACGCTCGAGTATGCCGTCAAGGAGTTG
GAAAAGGACATTGAGGCCGCTCGACAGCGCATGGGTGGCGACTTGCCCAAGACTCAGTTCTGCATCTTTGTCCTC
CACAACAAGGACAAGCCGAAAAAGGGCACGCTACCGGACGACATGCTCGCCACCCGGTACGAGGCGGCCGAGACG
GTCCAAGACGTCTGGATCAACTATCCATGGGAAGCCATCGACATTGACGAGCACGACGGGCTGGCGCGTGCTGCC
AAGGGGACTTGA
Transcript >Ophun1|7194
ATGGATGAAAAAATTTACGTCACGTACAACGATGTCCACAAGCTCTGCCAAAAGTCGGCCGTCCGCCTTCTAGCC
GATTTCAAGCCCCAGCTCATGATTGCCATCGGCGGAGGCGGCTACGTGCCTGCCCGCATCTTGCGCTCCTTTCTC
AAGCAGCCCGACTCGCCCAACATCCCCATCCAGGCCATCGGGCTCTCGCTCTACGAGTCCCTCGGCGGAACCGAG
GTCGAGGCTATCGGCAAAAAGGTCACCCGCACCCAATGGCTCGACCTCACTGCTCTAGGCGAGATGGAGAACCTG
GTCGGCAAGCGCGTCCTCATCGTCGACGAGGTTGACGACACCCGGACTACGCTCGAGTATGCCGTCAAGGAGTTG
GAAAAGGACATTGAGGCCGCTCGACAGCGCATGGGTGGCGACTTGCCCAAGACTCAGTTCTGCATCTTTGTCCTC
CACAACAAGGACAAGCCGAAAAAGGGCACGCTACCGGACGACATGCTCGCCACCCGGTACGAGGCGGCCGAGACG
GTCCAAGACGTCTGGATCAACTATCCATGGGAAGCCATCGACATTGACGAGCACGACGGGCTGGCGCGTGCTGCC
AAGGGGACTTGA
Gene >Ophun1|7194
ATGGATGAAAAAATTTACGTCACGTACAACGATGTGAATCACCCAGAGACCTCCCCGTTCTCCCCCCCTGACGCC
GGCTCCAGGTCCACAAGCTCTGCCAAAAGTCGGCCGTCCGCCTTCTAGCCGATTTCAAGCCCCAGCTCATGATTG
CCATCGGCGGAGGCGGCTACGTGCCTGCCCGCATCTTGCGCTCCTTTCTCAAGCAGCCCGACTCGCCCAACATCC
CCATCCAGGCCATCGGGCTCTCGCTCTACGAGTCCCTCGGCGGAACCGAGGTCGAGGCTATCGGCAAAAAGGTCA
CCCGCACCCAATGGCTCGACCTCACTGCTCTAGGCGAGATGGAGAACCTGGTCGGCAAGCGCGTCCTCATCGTCG
ACGAGGTTGACGACACCCGGACTACGCTCGAGTATGCCGTCAAGGAGTTGGAAAAGGACATTGAGGCCGCTCGAC
AGCGCATGGGTGGCGACTTGCCCAAGACTCAGTTCTGCATCTTTGTCCTCCACGTAAGGCTTCCAGTCTCCGTCC
GCCTTGCCCCCTCTCTGACGACGGTCCGCTGCAGAACAAGGACAAGCCGAAAAAGGGCACGCTACCGGACGACAT
GCTCGCCACCCGGTACGAGGCGGCCGAGACGGTCCAAGACGTCTGGATCAACTATCCATGGGAAGCCATCGACAT
TGACGAGCACGACGGGCTGGCGCGTGCTGCCAAGGGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail