Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7191
Gene name
LocationContig_87:36144..37158
Strand-
Gene length (bp)1014
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 1.9E-32 6 290

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P82594|IABF_STRCX Extracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Streptomyces chartreusis PE=1 SV=1 19 285 2.0E-23

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_26 2.5E-81 10 297

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6268
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01116
Ophiocordyceps camponoti-rufipedis Ophun1|7191 (this protein)
Ophiocordyceps kimflemingae Ophio5|3622
Ophiocordyceps subramaniannii Hirsu2|8003

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7191
MSNKTIADCDTPDPWIISSNNLFYFTFTLANRVEIWASPHLEDFRNCQKTTIWQPEPNSPWSADVWAPELHRIGG
KWYVYTCGAPPDTGNAGHRTLVLESEKEDPMDASGWTFLGPLKGMSDHWSIDATVFSISGDDLYCCWSGWPPGDT
SDTQQDLFLAKMANPTQVQAETTICICHASKAWERADEGARGVAEGPTWVDFAGFRGIVYSAHGSWTSEYKLGLI
ALDGNDPLRAKSWSKRAAPLLVSDKSHGGPFGPGHASFLPSPHSDGRIYCIYHGTSEYGQGWDNRKARVMSLGPE
AFAADAEPVCCHCGGCLKFSNTKDRVEQVMNKVKKFL*
Coding >Ophun1|7191
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCATATCCTCCAACAACCTCTTCTACTTC
ACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCGCCCCACCTCGAAGACTTCCGCAACTGCCAAAAGACA
ACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCTGACGTCTGGGCTCCGGAGCTGCACCGTATCGGGGGC
AAATGGTATGTCTATACTTGCGGTGCGCCCCCCGACACCGGCAACGCCGGTCATCGGACGCTGGTCCTCGAGAGC
GAGAAGGAGGATCCCATGGATGCCAGCGGGTGGACCTTTCTAGGTCCGCTCAAGGGCATGTCTGATCACTGGTCC
ATCGACGCCACCGTCTTCTCCATCTCGGGCGACGATCTCTACTGCTGCTGGAGCGGCTGGCCACCTGGAGATACG
AGCGACACGCAGCAAGACCTCTTCCTCGCCAAGATGGCCAACCCAACCCAAGTCCAAGCCGAAACCACCATCTGC
ATCTGCCACGCCTCCAAAGCCTGGGAACGCGCCGACGAAGGCGCCCGAGGCGTGGCAGAGGGTCCAACGTGGGTA
GACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTCATC
GCTCTGGACGGTAACGATCCCCTCCGCGCAAAGTCGTGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGATAAG
AGCCACGGCGGTCCCTTTGGTCCCGGACACGCGAGCTTCCTGCCCAGTCCCCACAGCGATGGCCGCATCTACTGC
ATCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAACCGCAAGGCGCGTGTCATGAGTCTTGGGCCTGAG
GCGTTTGCGGCGGATGCTGAGCCCGTGTGTTGTCACTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGATAGG
GTCGAGCAGGTTATGAACAAGGTGAAGAAGTTTCTGTGA
Transcript >Ophun1|7191
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCATATCCTCCAACAACCTCTTCTACTTC
ACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCGCCCCACCTCGAAGACTTCCGCAACTGCCAAAAGACA
ACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCTGACGTCTGGGCTCCGGAGCTGCACCGTATCGGGGGC
AAATGGTATGTCTATACTTGCGGTGCGCCCCCCGACACCGGCAACGCCGGTCATCGGACGCTGGTCCTCGAGAGC
GAGAAGGAGGATCCCATGGATGCCAGCGGGTGGACCTTTCTAGGTCCGCTCAAGGGCATGTCTGATCACTGGTCC
ATCGACGCCACCGTCTTCTCCATCTCGGGCGACGATCTCTACTGCTGCTGGAGCGGCTGGCCACCTGGAGATACG
AGCGACACGCAGCAAGACCTCTTCCTCGCCAAGATGGCCAACCCAACCCAAGTCCAAGCCGAAACCACCATCTGC
ATCTGCCACGCCTCCAAAGCCTGGGAACGCGCCGACGAAGGCGCCCGAGGCGTGGCAGAGGGTCCAACGTGGGTA
GACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTCATC
GCTCTGGACGGTAACGATCCCCTCCGCGCAAAGTCGTGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGATAAG
AGCCACGGCGGTCCCTTTGGTCCCGGACACGCGAGCTTCCTGCCCAGTCCCCACAGCGATGGCCGCATCTACTGC
ATCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAACCGCAAGGCGCGTGTCATGAGTCTTGGGCCTGAG
GCGTTTGCGGCGGATGCTGAGCCCGTGTGTTGTCACTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGATAGG
GTCGAGCAGGTTATGAACAAGGTGAAGAAGTTTCTGTGA
Gene >Ophun1|7191
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCATATCCTCCAACAACCTCTTCTACTTC
ACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCGCCCCACCTCGAAGACTTCCGCAACTGCCAAAAGACA
ACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCTGACGTCTGGGCTCCGGAGCTGCACCGTATCGGGGGC
AAATGGTATGTCTATACTTGCGGTGCGCCCCCCGACACCGGCAACGCCGGTCATCGGACGCTGGTCCTCGAGAGC
GAGAAGGAGGATCCCATGGATGCCAGCGGGTGGACCTTTCTAGGTCCGCTCAAGGGCATGTCTGATCACTGGTCC
ATCGACGCCACCGTCTTCTCCATCTCGGGCGACGATCTCTACTGCTGCTGGAGCGGCTGGCCACCTGGAGATACG
AGCGACACGCAGCAAGACCTCTTCCTCGCCAAGATGGCCAACCCAACCCAAGTCCAAGCCGAAACCACCATCTGC
ATCTGCCACGCCTCCAAAGCCTGGGAACGCGCCGACGAAGGCGCCCGAGGCGTGGCAGAGGGTCCAACGTGGGTA
GACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTCATC
GCTCTGGACGGTAACGATCCCCTCCGCGCAAAGTCGTGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGATAAG
AGCCACGGCGGTCCCTTTGGTCCCGGACACGCGAGCTTCCTGCCCAGTCCCCACAGCGATGGCCGCATCTACTGC
ATCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAACCGCAAGGCGCGTGTCATGAGTCTTGGGCCTGAG
GCGTTTGCGGCGGATGCTGAGCCCGTGTGTTGTCACTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGATAGG
GTCGAGCAGGTTATGAACAAGGTGAAGAAGTTTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail