Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7184
Gene name
LocationContig_87:24120..25799
Strand+
Gene length (bp)1679
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08164 TRAUB Apoptosis-antagonizing transcription factor, C-terminal 8.6E-27 420 503
PF13339 AATF-Che1 Apoptosis antagonizing transcription factor 1.4E-26 236 354

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I327|BFR2_GIBZE Protein BFR2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BFR2 PE=3 SV=1 1 540 9.0E-163
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 236 540 9.0E-94
sp|Q4WMI1|BFR2_ASPFU Protein bfr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bfr2 PE=3 SV=1 219 540 4.0E-42
sp|Q5AW04|BFR2_EMENI Protein bfr2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bfr2 PE=3 SV=1 222 540 3.0E-40
sp|Q6C9G2|BFR2_YARLI Protein BFR2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BFR2 PE=3 SV=1 235 513 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I327|BFR2_GIBZE Protein BFR2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BFR2 PE=3 SV=1 1 540 9.0E-163
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 236 540 9.0E-94
sp|Q4WMI1|BFR2_ASPFU Protein bfr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bfr2 PE=3 SV=1 219 540 4.0E-42
sp|Q5AW04|BFR2_EMENI Protein bfr2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bfr2 PE=3 SV=1 222 540 3.0E-40
sp|Q6C9G2|BFR2_YARLI Protein BFR2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BFR2 PE=3 SV=1 235 513 3.0E-32
sp|Q5ACL9|BFR2_CANAL Protein BFR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BFR2 PE=3 SV=2 224 511 1.0E-28
sp|Q06631|BFR2_YEAST Protein BFR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BFR2 PE=1 SV=1 230 513 8.0E-27
sp|Q9US05|BFR2_SCHPO Protein bfr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr2 PE=1 SV=1 236 511 2.0E-26
sp|Q6BXX1|BFR2_DEBHA Protein BFR2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BFR2 PE=3 SV=2 221 511 6.0E-26
sp|Q75EZ2|BFR2_ASHGO Protein BFR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BFR2 PE=3 SV=1 232 538 8.0E-26
sp|Q6FSD4|BFR2_CANGA Protein BFR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BFR2 PE=3 SV=1 233 522 4.0E-24
sp|Q5ZIM6|AATF_CHICK Protein AATF OS=Gallus gallus GN=AATF PE=2 SV=1 177 507 1.0E-23
sp|Q6CTS8|BFR2_KLULA Protein BFR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BFR2 PE=3 SV=1 230 513 7.0E-21
sp|Q4P5V5|BFR2_USTMA Protein BFR2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BFR2 PE=3 SV=1 236 538 3.0E-20
sp|P0CL90|BFR2_CRYNJ Protein BFR2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BFR2 PE=3 SV=1 226 504 9.0E-19
sp|P0CL91|BFR2_CRYNB Protein BFR2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BFR2 PE=3 SV=1 226 504 9.0E-19
sp|Q55E65|Y0496_DICDI Putative uncharacterized protein DDB_G0270496 OS=Dictyostelium discoideum GN=DDB_G0270496 PE=3 SV=2 244 504 5.0E-16
sp|Q9NY61|AATF_HUMAN Protein AATF OS=Homo sapiens GN=AATF PE=1 SV=1 199 511 2.0E-15
sp|Q7S6P8|BFR2_NEUCR Protein bfr2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bfr2 PE=3 SV=1 15 165 8.0E-15
sp|Q9JKX4|AATF_MOUSE Protein AATF OS=Mus musculus GN=Aatf PE=1 SV=1 239 505 2.0E-14
sp|Q9QYW0|AATF_RAT Protein AATF OS=Rattus norvegicus GN=Aatf PE=1 SV=1 239 510 3.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043231 intracellular membrane-bounded organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1280
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7746
Ophiocordyceps australis map64 (Brazil) OphauB2|7008
Ophiocordyceps camponoti-floridani Ophcf2|01123
Ophiocordyceps camponoti-rufipedis Ophun1|7184 (this protein)
Ophiocordyceps kimflemingae Ophio5|8200
Ophiocordyceps subramaniannii Hirsu2|1057

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7184
MVKLTTHAKKLAESDETIVRDDDVEGEAPRSGDASDSEDDDEAGTEHYVSAGKSRLRRKEGVSLGREYRGSRVSR
SVLAEASEAEDSEDDSESEHSQGPSENDAAYDDPEMADLAVDEAQAGDSEIDSDEAFVESDAGRFNNFSFRGSSK
SANLKRRATAADYMSSDEEEEQGGAGLASSDGEGDEDESDASAEGSNRSQDSGDESDEDSDDADDDADSGKQKVV
PRPEAMSTNTDKVKGLAIQKQRKVYDGLLNLRIRLQKALIAANTMPTLEEESCSDSEPYEAAEEAAVKLLNTMSS
LRDNMTSSSHRTGEKRKRTLSTSMSSEAIWKCLQDEDLQAADFRRERLEKWSRKVQSVSVTATKGLSQKSQTLME
ALEEQLANPEGRLMKRTRVARSCAPAQAAKKVVEDDDIYDDADFYQLLLKELVDQRTVETWTAQSSGVRSVMVTA
TKEAKMGKQVDRKASKGRKMRFTVHEKLQNLMAPEDRRSWEQAAIDRLFGTLFGRKMALDEEESSDSGDSGDRGD
SGDRGDSAGLRLFRSEG*
Coding >Ophun1|7184
ATGGTGAAATTAACAACTCACGCCAAGAAACTCGCCGAGTCTGACGAGACTATCGTCAGAGATGATGATGTCGAA
GGCGAGGCGCCGAGGAGCGGCGACGCTTCTGACAGTGAGGATGACGACGAGGCTGGGACGGAGCACTATGTCTCT
GCAGGGAAGAGCCGATTGAGACGGAAGGAGGGAGTTTCTCTGGGTCGAGAGTATAGAGGCTCTCGCGTCAGCCGA
TCCGTGCTCGCGGAGGCCAGCGAAGCCGAGGATTCTGAAGATGATAGCGAGTCTGAACACTCGCAAGGGCCCAGC
GAGAATGATGCCGCATACGATGACCCGGAAATGGCCGATCTCGCTGTCGACGAAGCTCAAGCTGGTGACTCGGAA
ATCGACAGCGACGAGGCCTTTGTTGAGTCTGATGCGGGGCGTTTTAATAATTTCTCTTTTCGTGGCAGCTCCAAA
TCAGCAAACTTGAAGCGCAGAGCGACTGCGGCAGACTACATGTCCTCCGACGAGGAAGAAGAGCAGGGCGGAGCA
GGGCTGGCCAGTTCAGACGGGGAGGGTGATGAGGATGAGAGTGATGCCTCGGCAGAAGGATCGAATCGCTCACAA
GACTCTGGAGATGAGTCAGACGAGGACTCTGATGATGCCGACGATGATGCCGACTCGGGGAAACAAAAGGTCGTG
CCCAGACCAGAAGCCATGTCCACCAACACGGACAAGGTAAAAGGCCTGGCAATCCAAAAGCAGCGGAAGGTGTAC
GACGGCCTCTTGAACCTGCGCATCCGGCTTCAGAAAGCGCTGATAGCGGCCAATACGATGCCCACGTTGGAGGAA
GAGTCTTGTTCAGATTCGGAGCCTTACGAGGCGGCCGAGGAGGCAGCTGTCAAGCTCCTCAACACCATGAGCAGC
CTCAGAGACAATATGACGAGCTCGAGTCACCGCACCGGCGAAAAACGGAAACGGACATTGTCGACTTCGATGTCG
AGCGAGGCCATCTGGAAGTGCCTACAAGATGAGGACCTGCAGGCGGCCGACTTCCGGAGAGAGCGACTGGAAAAG
TGGTCGCGTAAGGTGCAGAGCGTCAGCGTTACGGCAACCAAAGGCCTCAGTCAAAAGAGCCAGACGCTGATGGAA
GCACTCGAGGAGCAACTGGCCAACCCCGAGGGCCGACTCATGAAGCGCACGCGCGTGGCCAGATCATGTGCTCCG
GCGCAGGCAGCGAAGAAGGTGGTGGAGGATGACGACATCTACGACGACGCCGACTTCTACCAGCTGCTGCTAAAA
GAGCTCGTCGACCAGCGAACGGTGGAGACGTGGACGGCGCAAAGCAGCGGAGTGCGCAGCGTCATGGTGACGGCG
ACGAAGGAAGCCAAGATGGGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCAGAAAGATGCGGTTCACGGTGCAC
GAGAAGCTGCAGAACCTGATGGCGCCCGAAGATCGACGCAGCTGGGAGCAGGCGGCCATCGACAGGCTGTTTGGA
ACACTGTTTGGCCGCAAGATGGCGCTGGACGAGGAGGAGAGTTCGGACTCGGGGGACTCGGGGGACAGAGGGGAC
TCGGGGGACAGAGGGGACTCGGCCGGACTGCGACTGTTTCGTAGCGAGGGCTAG
Transcript >Ophun1|7184
ATGGTGAAATTAACAACTCACGCCAAGAAACTCGCCGAGTCTGACGAGACTATCGTCAGAGATGATGATGTCGAA
GGCGAGGCGCCGAGGAGCGGCGACGCTTCTGACAGTGAGGATGACGACGAGGCTGGGACGGAGCACTATGTCTCT
GCAGGGAAGAGCCGATTGAGACGGAAGGAGGGAGTTTCTCTGGGTCGAGAGTATAGAGGCTCTCGCGTCAGCCGA
TCCGTGCTCGCGGAGGCCAGCGAAGCCGAGGATTCTGAAGATGATAGCGAGTCTGAACACTCGCAAGGGCCCAGC
GAGAATGATGCCGCATACGATGACCCGGAAATGGCCGATCTCGCTGTCGACGAAGCTCAAGCTGGTGACTCGGAA
ATCGACAGCGACGAGGCCTTTGTTGAGTCTGATGCGGGGCGTTTTAATAATTTCTCTTTTCGTGGCAGCTCCAAA
TCAGCAAACTTGAAGCGCAGAGCGACTGCGGCAGACTACATGTCCTCCGACGAGGAAGAAGAGCAGGGCGGAGCA
GGGCTGGCCAGTTCAGACGGGGAGGGTGATGAGGATGAGAGTGATGCCTCGGCAGAAGGATCGAATCGCTCACAA
GACTCTGGAGATGAGTCAGACGAGGACTCTGATGATGCCGACGATGATGCCGACTCGGGGAAACAAAAGGTCGTG
CCCAGACCAGAAGCCATGTCCACCAACACGGACAAGGTAAAAGGCCTGGCAATCCAAAAGCAGCGGAAGGTGTAC
GACGGCCTCTTGAACCTGCGCATCCGGCTTCAGAAAGCGCTGATAGCGGCCAATACGATGCCCACGTTGGAGGAA
GAGTCTTGTTCAGATTCGGAGCCTTACGAGGCGGCCGAGGAGGCAGCTGTCAAGCTCCTCAACACCATGAGCAGC
CTCAGAGACAATATGACGAGCTCGAGTCACCGCACCGGCGAAAAACGGAAACGGACATTGTCGACTTCGATGTCG
AGCGAGGCCATCTGGAAGTGCCTACAAGATGAGGACCTGCAGGCGGCCGACTTCCGGAGAGAGCGACTGGAAAAG
TGGTCGCGTAAGGTGCAGAGCGTCAGCGTTACGGCAACCAAAGGCCTCAGTCAAAAGAGCCAGACGCTGATGGAA
GCACTCGAGGAGCAACTGGCCAACCCCGAGGGCCGACTCATGAAGCGCACGCGCGTGGCCAGATCATGTGCTCCG
GCGCAGGCAGCGAAGAAGGTGGTGGAGGATGACGACATCTACGACGACGCCGACTTCTACCAGCTGCTGCTAAAA
GAGCTCGTCGACCAGCGAACGGTGGAGACGTGGACGGCGCAAAGCAGCGGAGTGCGCAGCGTCATGGTGACGGCG
ACGAAGGAAGCCAAGATGGGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCAGAAAGATGCGGTTCACGGTGCAC
GAGAAGCTGCAGAACCTGATGGCGCCCGAAGATCGACGCAGCTGGGAGCAGGCGGCCATCGACAGGCTGTTTGGA
ACACTGTTTGGCCGCAAGATGGCGCTGGACGAGGAGGAGAGTTCGGACTCGGGGGACTCGGGGGACAGAGGGGAC
TCGGGGGACAGAGGGGACTCGGCCGGACTGCGACTGTTTCGTAGCGAGGGCTAG
Gene >Ophun1|7184
ATGGTGAAATTAACAACTCACGCCAAGAAACTCGCCGAGTCTGACGAGACTATCGTCAGAGGTGTGTAAAGATCT
TTTTTAACGAGCAAACCTTGACTAATTCGGCCGCAGATGATGATGTCGAAGGCGAGGCGCCGAGGAGCGGCGACG
CTTCTGACAGTGAGGATGACGACGAGGCTGGGACGGAGCACTATGTCTCTGCAGGGAAGAGCCGATTGAGACGGA
AGGAGGGAGTTTCTCTGGGTCGAGAGTATAGAGGCTCTCGCGTCAGCCGATCCGTGCTCGCGGAGGCCAGCGAAG
CCGAGGATTCTGAAGATGATAGCGAGTCTGAACACTCGCAAGGGCCCAGCGAGAATGATGCCGCATACGATGACC
CGGAAATGGCCGATCTCGCTGTCGACGAAGCTCAAGCTGGTGACTCGGAAATCGACAGCGACGAGGCCTTTGTTG
AGTCTGATGCGGGGCGTTTTAATAATTTCTCTTTTCGTGGCAGCTCCAAATCAGCAAACTTGAAGCGCAGAGCGA
CTGCGGCAGACTACATGTCCTCCGACGAGGAAGAAGAGCAGGGCGGAGCAGGGCTGGCCAGTTCAGACGGGGAGG
GTGATGAGGATGAGAGTGATGCCTCGGCAGAAGGATCGAATCGCTCACAAGACTCTGGAGATGAGTCAGACGAGG
ACTCTGATGATGCCGACGATGATGCCGACTCGGGGAAACAAAAGGTCGTGCCCAGACCAGAAGCCATGTCCACCA
ACACGGACAAGGTAAAAGGCCTGGCAATCCAAAAGCAGCGGAAGGTGTACGACGGCCTCTTGAACCTGCGCATCC
GGCTTCAGAAAGCGCTGATAGCGGCCAATACGATGCCCACGTTGGAGGAAGAGTCTTGTTCAGATTCGGAGCCTT
ACGAGGCGGCCGAGGAGGCAGCTGTCAAGCTCCTCAACACCATGAGCAGCCTCAGAGACAATATGACGAGCTCGA
GTCACCGCACCGGCGAAAAACGGAAACGGACATTGTCGACTTCGATGTCGAGCGAGGCCATCTGGAAGTGCCTAC
AAGATGAGGACCTGCAGGCGGCCGACTTCCGGAGAGAGCGACTGGAAAAGTGGTCGCGTAAGGTGCAGAGCGTCA
GCGTTACGGCAACCAAAGGCCTCAGTCAAAAGAGCCAGACGCTGATGGAAGCACTCGAGGAGCAACTGGCCAACC
CCGAGGGCCGACTCATGAAGCGCACGCGCGTGGCCAGATCATGTGCTCCGGCGCAGGCAGCGAAGAAGGTGGTGG
AGGATGACGACATCTACGACGACGCCGACTTCTACCAGCTGCTGCTAAAAGAGCTCGTCGACCAGCGAACGGTGG
AGACGTGGACGGCGCAAAGCAGCGGAGTGCGCAGCGTCATGGTGACGGCGACGAAGGAAGCCAAGATGGGCAAGC
AGGTGGATCGCAAGGCGAGCAAGGGCAGAAAGATGCGGTTCACGGTGCACGAGAAGCTGCAGAACCTGATGGCGC
CCGAAGATCGACGCAGCTGGGAGCAGGCGGCCATCGACAGGCTGTTTGGAACACTGTTTGGCCGCAAGATGGCGC
TGGACGAGGAGGAGAGTTCGGACTCGGGGGACTCGGGGGACAGAGGGGACTCGGGGGACAGAGGGGACTCGGCCG
GACTGCGACTGTTTCGTAGCGAGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail