Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7175
Gene name
LocationContig_87:5237..8406
Strand+
Gene length (bp)3169
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.2E-170 152 840

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 81 876 3.0E-141
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 5 862 2.0E-138
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 131 876 6.0E-121
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 115 863 4.0E-110
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 131 867 1.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 81 876 3.0E-141
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 5 862 2.0E-138
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 131 876 6.0E-121
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 115 863 4.0E-110
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 131 867 1.0E-108
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 131 869 1.0E-106
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 131 876 1.0E-106
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 115 864 6.0E-104
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 131 869 1.0E-103
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 132 865 4.0E-101
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 136 865 2.0E-97
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 136 865 9.0E-93
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 136 865 3.0E-90
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 108 865 6.0E-87
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 266 285 19
2 295 317 22
3 338 360 22
4 375 392 17
5 412 434 22
6 485 507 22
7 564 586 22
8 591 613 22
9 620 642 22
10 672 694 22
11 738 760 22
12 785 807 22
13 819 841 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7175
MPTRKIRVDEDQATMKEAMENGRGSNKGDKAIVLEKIPSDDAETTGSLKQLDATEDDILEARELAASMSLETVHG
MMKEVLADHENDPNFNHATLEVIKTFLSNQDVLLNPEKHEHLVERIKLEAALIATNSPYAEVRANVDNHDKADMP
VSTIRAWTLGCLFSVLLSFVNQLFSVRQPSIKFETNVAQLLSYPLGKCWERWMPRYDMPIPFTGRSVSLNPGPFN
KKEHMLIAIMANTSKSLPYTNFMIWTQVLPQGFNQQYARSAGYMFLNAFATNFIGYGLAGVMRKILVKPAYCIWP
TVFSTIALNAALHPGAGDETKTVRGPMRTTWSMSRYRFFLYTFFAMLVYFWFPNYLFQALSYFSWMTWIAPDNLT
LNILTGMQNGLGLFNPFPTFDWNCMTYITDPLMLPSTTTFNAVGGMFLTGLLIPIAWFTNTWNTGYLPIITNRVH
DHFGKLYNISNALDSRGMFDAKKYVKYSRPYLGAANALAYGWHFAIYTAIITHVLLYHRPQMIMGFKSIFKSLRC
AFFRKKKKTDRSAGNAREEEKYPDVHNRLMSAYAEIPEWWFCLILAISMILGILGIVLWPTYTSPAVVLYGILLC
LLFIVPIGVTVSMTGMEITLNVLAEFIGGVIVEGNALAMNFFKSYGYITCAHAVSFLQDLKIAHYVKIPPRVTFM
GQMVATLISTSVCTGVFMFQMNIKDVCTESAPMRFFCPGPNTFMTASVLWGTIGPIKVFGKEGYYRWLLMGFPVG
FLLVFIVWALQRRYPDSGFLRRINVVVAIAGSLQWAPYSFSYAWPALPVAWFSWIYVRSRYLNFWSRYNYVLSAS
LSAGVAISAIIMLFTVQWAGINVVWWGNTQPFKGCEGEPCRLYKLAEGERF*
Coding >Ophun1|7175
ATGCCGACTCGCAAGATCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAGGCCATCGTCCTGGAGAAGATACCCTCGGACGATGCCGAGACGACGGGTAGCCTCAAACAG
CTCGATGCCACCGAGGATGATATTCTCGAGGCCAGGGAGTTGGCGGCCTCGATGAGCCTGGAGACGGTTCATGGA
ATGATGAAGGAGGTTTTGGCAGACCACGAGAACGACCCCAACTTCAATCACGCCACCTTAGAGGTCATCAAGACG
TTTCTGTCCAACCAAGATGTCCTCCTCAATCCCGAGAAGCACGAGCACCTCGTGGAACGAATCAAGCTCGAAGCA
GCCCTCATCGCAACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGACAACCACGACAAGGCCGACATGCCC
GTGTCGACGATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTCTCCTTCGTCAACCAGCTCTTCTCG
GTCCGACAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGCTGCTATCGTACCCGCTGGGGAAATGCTGGGAG
AGATGGATGCCCCGATACGACATGCCCATCCCCTTTACCGGCCGCAGCGTGAGCCTCAACCCGGGCCCGTTCAAC
AAGAAAGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTTCCCTACACCAACTTTATGATCTGG
ACGCAAGTGTTGCCTCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGATACATGTTCCTCAACGCCTTTGCT
ACCAACTTCATCGGCTACGGACTGGCGGGCGTCATGCGTAAGATCCTCGTCAAGCCGGCTTATTGCATCTGGCCA
ACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGGGATGAGACCAAGACGGTCAGAGGG
CCGATGCGAACGACGTGGTCCATGTCTCGATACCGCTTCTTTCTCTACACCTTCTTTGCCATGCTCGTGTACTTT
TGGTTCCCCAACTATCTGTTTCAGGCGCTGTCGTACTTTTCGTGGATGACGTGGATTGCGCCGGACAACCTGACG
TTGAATATCTTGACGGGAATGCAGAACGGACTGGGGCTGTTCAACCCCTTTCCGACCTTTGACTGGAACTGCATG
ACCTACATTACCGATCCGCTGATGCTCCCCTCTACCACAACCTTCAACGCCGTCGGCGGCATGTTCCTCACCGGC
CTCCTGATCCCCATCGCCTGGTTCACAAACACATGGAACACGGGCTACCTGCCCATCATCACAAACCGAGTCCAC
GATCACTTCGGCAAGCTGTACAACATCTCCAACGCCCTCGACTCGCGCGGCATGTTCGATGCCAAAAAGTACGTC
AAGTATTCGCGTCCTTACCTCGGGGCCGCCAACGCGCTGGCCTACGGCTGGCACTTTGCCATTTATACGGCTATT
ATCACGCACGTGCTGCTCTATCACAGGCCTCAGATGATCATGGGCTTCAAGAGCATCTTTAAGAGTCTTCGCTGT
GCATTCTTTAGAAAGAAGAAGAAGACGGATCGGAGTGCCGGGAACGCAAGGGAGGAGGAGAAATACCCGGACGTC
CACAACCGCTTGATGTCGGCTTATGCCGAGATCCCTGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATGATA
CTCGGCATCCTTGGAATCGTCCTCTGGCCAACCTACACCTCGCCCGCCGTCGTCCTTTACGGCATTTTGCTGTGT
CTTCTCTTCATCGTCCCCATTGGCGTGACGGTTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTGGCCGAG
TTCATTGGCGGCGTCATCGTCGAGGGCAACGCGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACATGT
GCACACGCCGTTTCCTTTCTTCAGGATCTCAAGATCGCTCACTATGTCAAGATCCCTCCTCGTGTTACCTTTATG
GGCCAGATGGTGGCCACGCTGATCTCTACCTCTGTCTGCACCGGCGTCTTCATGTTCCAGATGAACATCAAAGAC
GTCTGCACCGAGTCAGCCCCCATGAGGTTCTTCTGCCCCGGCCCCAACACCTTCATGACAGCCTCTGTCCTCTGG
GGAACCATCGGCCCCATCAAGGTATTCGGTAAAGAAGGCTACTACAGGTGGCTCCTGATGGGTTTCCCCGTCGGC
TTCCTCCTCGTCTTCATAGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCCGGCTTCCTTCGACGGATCAACGTC
GTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTACAGCTTCTCGTACGCGTGGCCAGCGCTGCCCGTCGCC
TGGTTCTCGTGGATCTACGTCCGCAGCCGCTATCTCAACTTCTGGTCGCGGTACAACTACGTTCTCTCGGCCTCG
CTCTCGGCTGGCGTCGCCATCTCTGCCATCATCATGCTCTTTACCGTCCAGTGGGCGGGTATTAATGTCGTCTGG
TGGGGGAATACTCAGCCGTTCAAGGGCTGTGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGCTGAAGGGGAGAGG
TTCTGA
Transcript >Ophun1|7175
ATGCCGACTCGCAAGATCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAGGCCATCGTCCTGGAGAAGATACCCTCGGACGATGCCGAGACGACGGGTAGCCTCAAACAG
CTCGATGCCACCGAGGATGATATTCTCGAGGCCAGGGAGTTGGCGGCCTCGATGAGCCTGGAGACGGTTCATGGA
ATGATGAAGGAGGTTTTGGCAGACCACGAGAACGACCCCAACTTCAATCACGCCACCTTAGAGGTCATCAAGACG
TTTCTGTCCAACCAAGATGTCCTCCTCAATCCCGAGAAGCACGAGCACCTCGTGGAACGAATCAAGCTCGAAGCA
GCCCTCATCGCAACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGACAACCACGACAAGGCCGACATGCCC
GTGTCGACGATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTCTCCTTCGTCAACCAGCTCTTCTCG
GTCCGACAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGCTGCTATCGTACCCGCTGGGGAAATGCTGGGAG
AGATGGATGCCCCGATACGACATGCCCATCCCCTTTACCGGCCGCAGCGTGAGCCTCAACCCGGGCCCGTTCAAC
AAGAAAGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTTCCCTACACCAACTTTATGATCTGG
ACGCAAGTGTTGCCTCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGATACATGTTCCTCAACGCCTTTGCT
ACCAACTTCATCGGCTACGGACTGGCGGGCGTCATGCGTAAGATCCTCGTCAAGCCGGCTTATTGCATCTGGCCA
ACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGGGATGAGACCAAGACGGTCAGAGGG
CCGATGCGAACGACGTGGTCCATGTCTCGATACCGCTTCTTTCTCTACACCTTCTTTGCCATGCTCGTGTACTTT
TGGTTCCCCAACTATCTGTTTCAGGCGCTGTCGTACTTTTCGTGGATGACGTGGATTGCGCCGGACAACCTGACG
TTGAATATCTTGACGGGAATGCAGAACGGACTGGGGCTGTTCAACCCCTTTCCGACCTTTGACTGGAACTGCATG
ACCTACATTACCGATCCGCTGATGCTCCCCTCTACCACAACCTTCAACGCCGTCGGCGGCATGTTCCTCACCGGC
CTCCTGATCCCCATCGCCTGGTTCACAAACACATGGAACACGGGCTACCTGCCCATCATCACAAACCGAGTCCAC
GATCACTTCGGCAAGCTGTACAACATCTCCAACGCCCTCGACTCGCGCGGCATGTTCGATGCCAAAAAGTACGTC
AAGTATTCGCGTCCTTACCTCGGGGCCGCCAACGCGCTGGCCTACGGCTGGCACTTTGCCATTTATACGGCTATT
ATCACGCACGTGCTGCTCTATCACAGGCCTCAGATGATCATGGGCTTCAAGAGCATCTTTAAGAGTCTTCGCTGT
GCATTCTTTAGAAAGAAGAAGAAGACGGATCGGAGTGCCGGGAACGCAAGGGAGGAGGAGAAATACCCGGACGTC
CACAACCGCTTGATGTCGGCTTATGCCGAGATCCCTGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATGATA
CTCGGCATCCTTGGAATCGTCCTCTGGCCAACCTACACCTCGCCCGCCGTCGTCCTTTACGGCATTTTGCTGTGT
CTTCTCTTCATCGTCCCCATTGGCGTGACGGTTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTGGCCGAG
TTCATTGGCGGCGTCATCGTCGAGGGCAACGCGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACATGT
GCACACGCCGTTTCCTTTCTTCAGGATCTCAAGATCGCTCACTATGTCAAGATCCCTCCTCGTGTTACCTTTATG
GGCCAGATGGTGGCCACGCTGATCTCTACCTCTGTCTGCACCGGCGTCTTCATGTTCCAGATGAACATCAAAGAC
GTCTGCACCGAGTCAGCCCCCATGAGGTTCTTCTGCCCCGGCCCCAACACCTTCATGACAGCCTCTGTCCTCTGG
GGAACCATCGGCCCCATCAAGGTATTCGGTAAAGAAGGCTACTACAGGTGGCTCCTGATGGGTTTCCCCGTCGGC
TTCCTCCTCGTCTTCATAGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCCGGCTTCCTTCGACGGATCAACGTC
GTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTACAGCTTCTCGTACGCGTGGCCAGCGCTGCCCGTCGCC
TGGTTCTCGTGGATCTACGTCCGCAGCCGCTATCTCAACTTCTGGTCGCGGTACAACTACGTTCTCTCGGCCTCG
CTCTCGGCTGGCGTCGCCATCTCTGCCATCATCATGCTCTTTACCGTCCAGTGGGCGGGTATTAATGTCGTCTGG
TGGGGGAATACTCAGCCGTTCAAGGGCTGTGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGCTGAAGGGGAGAGG
TTCTGA
Gene >Ophun1|7175
ATGCCGACTCGCAAGATCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAGGCCATCGTCCTGGAGAAGATAGTGAGTCGTTTTGGTGTTCCGACGCGCGGAACAGCTCTG
ACGGATGCCGTCTTGTTCCGCAGCCCTCGGACGATGCCGAGACGACGGGTAGCCTCAAGTCGGGTTTCCCCCTTG
GCCGTCAAGGCGTCCGGCTGTGGCTGACGTGCTCGCGGGCAGACAGCTCGATGCCACCGAGGATGATATTCTCGA
GGCCAGGGAGTTGGCGGCCTCGATGAGCCTGGAGACGGTTCATGGAGTTGGTCTTGATGCCTCCAGCTGAACCGC
GTCTGTGTCTGACGTTGACACCTTAGATGATGAAGGAGGTTTTGGCAGACCACGAGAACGACCCCAACTTCAATC
ACGCCACCTTAGAGGTCATCAAGACGTTTCTGTGTACGAGCCTCCTCCATCTCTGCTTCACCCCCTTTTTCAATC
CCCCCTTGCCCCTGACAGTCCCAACCGGCAGCCAACCAAGATGTCCTCCTCAATCCCGAGAAGCACGAGCACCTC
GTGGAACGAATCAAGCTCGAAGCAGCCCTCATCGCAACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGAC
AACCACGACAAGGCCGACATGCCCGTGTCGACGATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTC
TCCTTCGTCAACCAGCTCTTCTCGGTCCGACAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGCTGCTATCG
TACCCGCTGGGGAAATGCTGGGAGAGATGGATGCCCCGATACGACATGCCCATCCCCTTTACCGGCCGCAGCGTG
AGCCTCAACCCGGGCCCGTTCAACAAGAAAGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTT
CCCTACACCAACTTTATGATCTGGACGCAAGTGTTGCCTCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGA
TACATGTTCCTCAACGCCTTTGCTACCAACTTCATCGGCTACGGACTGGCGGGCGTCATGCGTAAGATCCTCGTC
AAGCCGGCTTATTGCATCTGGCCAACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGG
GATGAGACCAAGACGGTCAGAGGGCCGATGCGAACGACGTGGTCCATGTCTCGATACCGCTTCTTTCTCTACACC
TTCTTTGCCATGCTCGTGTACTTTTGGTTCCCCAACTATCTGTTTCAGGCGCTGTCGTACTTTTCGTGGATGACG
TGGATTGCGCCGGACAACCTGACGTTGAATATCTTGACGGGAATGCAGAACGGACTGGGGGTATGTTTTCTCGAG
GTTCTTCGGAGTTGCTGTGTGGTTCTTGGAGTTGTCTTGATTGATAGAGATGCTGACATCGAGACAGCTGTTCAA
CCCCTTTCCGACCTTTGACTGGAACTGCATGACCTACATTACCGATCCGCTGGTCTGTTCCCTCTCGTTATTAAC
TCAGCTACCGTACTCTAACTTACACACGATAGATGCTCCCCTCTACCACAACCTTCAACGCCGTCGGCGGCATGT
TCCTCACCGGCCTCCTGATCCCCATCGCCTGGTTCACAAACACATGGAACACGGGCTACCTGCCCATCATCACAA
ACCGAGTCCACGATCACTTCGGCAAGCTGTACAACATCTCCAACGCCCTCGACTCGCGCGGCATGTTCGATGCCA
AAAAGTACGTCAAGTATTCGCGTCCTTACCTCGGGGCCGCCAACGCGCTGGCCTACGGCTGGCACTTTGCCATTT
ATACGGCTATTATCACGCACGTGCTGCTCTATCACAGGCCTCAGATGATCATGGGCTTCAAGAGCATCTTTAAGA
GTCTTCGCTGTGCATTCTTTAGAAAGAAGAAGAAGACGGATCGGAGTGCCGGGAACGCAAGGGAGGAGGAGAAAT
ACCCGGACGTCCACAACCGCTTGATGTCGGCTTATGCCGAGAGTAAGCGTTCTTATACTGAACCCGAGAGATACG
GAACACTGACATGTTATCTAGTCCCTGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATGATACTCGGCATCC
TTGGAATCGTCCTCTGGCCAACCTACACCTCGCCCGCCGTCGTCCTTTACGGCATTTTGCTGTGTCTTCTCTTCA
TCGTCCCCATTGGCGTGACGGTTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTGGCCGAGTTCATTGGCG
GCGTCATCGTCGAGGGCAACGCGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACATGTGCACACGCCG
TTTCCTTTCTTCAGGATCTCAAGATCGCTCACTATGTCAAGGTATAGTTGTGAGAGACCATTATCAGAGCTGACA
GATGGCTGACCCGAACAGATCCCTCCTCGTGTTACCTTTATGGGCCAGATGGTGGCCACGCTGATCTCTACCTCT
GTCTGCACCGGCGTCTTCATGTTCCAGGTATGCCGTCCTCCGAGAACAGAGAGATCTCAGCTGAGCCCTGTAGAT
GAACATCAAAGACGTCTGCACCGAGTCAGCCCCCATGAGGTTCTTCTGCCCCGGCCCCAACACCTTCATGACAGC
CTCTGTCCTCTGGGGAACCATCGGCCCCATCAAGGTATTCGGTAAAGAAGGCTACTACAGGTGGCTCCTGATGGG
TTTCCCCGTCGGCTTCCTCCTCGTCTTCATAGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCCGGCTTCCTTCG
ACGGATCAACGTCGTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTACAGCTTCTCGTACGCGTGGCCAGC
GCTGCCCGTCGCCTGGTTCTCGTGGATCTACGTCCGCAGCCGCTATCTCAACTTCTGGTCGCGGTACAACTACGT
TCTCTCGGCCTCGCTCTCGGCTGGCGTCGCCATCTCTGCCATCATCATGCTCTTTACCGTCCAGTGGGCGGGTAT
TAATGTCGTCTGGTGGGGGAATACTCAGCCGTTCAAGGGCTGTGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGC
TGAAGGGGAGAGGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail