Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7172
Gene name
LocationContig_869:1135..3488
Strand-
Gene length (bp)2353
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19031 Intu_longin_1 First Longin domain of INTU, CCZ1 and HPS4 1.2E-07 19 128

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3348
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6764
Ophiocordyceps australis map64 (Brazil) OphauB2|7993
Ophiocordyceps camponoti-floridani Ophcf2|01996
Ophiocordyceps camponoti-rufipedis Ophun1|7172 (this protein)
Ophiocordyceps kimflemingae Ophio5|679
Ophiocordyceps subramaniannii Hirsu2|6232

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7172
MASAAASSPGAVVPARLGFLAIYNPSLGSTDDTVDDQIVYYASVTTQASSSRRRRRRDRARARPTDGLDPQERNE
RLRQIGLAQGMVSFSSGFADGAAVDAIDTDRARVIVHELEPGWWILASIDLTKLPLPPRLNATEESFEYSSREMK
PASLLLRDLLRAHSIFLMHHGSSLSALFVHCRRSKFMALLGRYWDLFLSTWNVLLHGNPARDIFGAINVAASGEL
GVGVGEEDRGSGEREVLEGLVGRIEGLVDLVVSKFGPDEPKSVAGGEEEPWLGTGREPAADDGAVFLGTGALSRK
TLRDVTHWMEDLYTWGEHAYGVIESPTSVRRNKARGAVGEAAEGEVAGPGPEPEPEPGEAKTTPEVPEIKMTGPT
EAETSEPPEIKTTEPTEAETTSEPPETKTNPLPSQQVDNNKPSQDGKLDKMLSYMKLGYGSYWKLPGESTTSSKP
PAVRPTPPPRASSGRGRFLIGLTGDMDEEQVTAGDDDGDSSGSEAAEHNSRTVLRTVHVEIESGMRRPETTIVKD
FVNPASELTQSQLMGSMLSGFGSHDVNKADKLRVVIYVNQPFILAFFFRLRTDSLAWDTLYRSLHYQLAPLRRPL
LSSTRYRPPSSQPPGGLYSLVWDPVLLTVRAAVPNIPDQQPRLEADSALLDAFWSRADAASTHLQLLLLHAATRS
LTGAVERTLKTSRGWWIVWTRLGGQAGEDEEMEAAASSVDGSIVGPGAAKEIFLVRRASDHAGADGVAAAGIGVD
TRRYVEELLSLL*
Coding >Ophun1|7172
ATGGCCTCAGCCGCTGCCTCGTCTCCAGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCCATCTACAACCCA
TCGCTGGGCAGCACAGACGATACAGTCGACGACCAGATCGTCTACTACGCCTCCGTCACCACCCAAGCCTCATCA
TCGCGCCGTCGCCGTCGCAGAGACAGAGCAAGGGCACGACCGACCGACGGGCTCGACCCGCAAGAACGCAATGAG
CGTCTGCGCCAGATCGGGCTGGCTCAGGGAATGGTCAGCTTCAGCAGTGGGTTCGCTGACGGGGCTGCCGTCGAT
GCTATTGATACGGACCGCGCTCGTGTCATCGTCCATGAGCTGGAGCCTGGCTGGTGGATCCTGGCCAGCATCGAC
CTGACCAAGCTTCCGCTGCCGCCGCGTCTGAACGCTACGGAAGAATCGTTCGAGTACTCTTCGCGAGAGATGAAG
CCGGCTTCGCTGCTGCTCCGCGATCTGCTTCGCGCACATAGCATCTTCCTCATGCACCACGGCTCGTCCCTCAGC
GCCCTCTTCGTCCACTGCCGCCGCTCCAAGTTCATGGCCTTGCTCGGTCGGTACTGGGATCTGTTCCTGTCGACG
TGGAATGTCCTGCTGCATGGCAATCCGGCCAGGGATATCTTTGGCGCCATCAACGTCGCCGCCTCGGGCGAGCTG
GGCGTTGGCGTCGGCGAAGAGGATCGTGGGAGCGGAGAGCGGGAGGTGCTGGAGGGTTTGGTGGGCAGGATAGAG
GGCTTGGTTGACCTCGTCGTCTCCAAGTTTGGTCCTGACGAGCCGAAGTCTGTTGCTGGGGGGGAGGAGGAGCCC
TGGCTGGGCACGGGTCGGGAGCCGGCGGCTGATGATGGTGCCGTCTTTCTAGGTACGGGAGCGCTGTCGAGGAAG
ACGCTGCGGGATGTGACGCACTGGATGGAGGATCTGTATACCTGGGGTGAGCATGCCTATGGCGTCATTGAGAGT
CCTACGTCGGTTCGACGCAATAAGGCTCGTGGTGCCGTCGGGGAGGCGGCTGAGGGCGAGGTGGCGGGGCCGGGG
CCGGAGCCGGAGCCGGAGCCGGGAGAGGCCAAGACGACGCCGGAAGTGCCGGAGATTAAGATGACGGGACCGACG
GAAGCCGAGACGTCGGAGCCACCAGAGATTAAGACGACGGAACCGACAGAAGCCGAGACGACGTCGGAACCCCCA
GAAACAAAGACTAACCCCCTTCCCTCGCAGCAAGTCGATAACAACAAACCCAGCCAAGATGGCAAGCTGGACAAG
ATGCTCAGCTACATGAAGCTCGGCTACGGCTCCTACTGGAAGCTTCCCGGAGAGTCGACAACGTCCAGCAAGCCC
CCTGCTGTCCGACCAACCCCCCCTCCCCGCGCCTCTTCTGGTCGCGGACGCTTCCTCATCGGCCTCACGGGCGAC
ATGGACGAGGAGCAGGTAACGGCCGGCGACGACGATGGCGACTCCAGCGGCTCTGAGGCGGCTGAGCACAACTCG
CGGACCGTTCTGCGGACGGTGCACGTCGAGATTGAAAGCGGCATGCGACGGCCCGAGACGACCATCGTCAAGGAC
TTTGTCAATCCGGCCAGCGAGCTGACGCAGTCGCAGCTCATGGGCAGCATGTTGTCCGGCTTCGGCTCTCACGAC
GTCAACAAGGCCGACAAGCTACGCGTCGTCATCTACGTCAACCAGCCCTTCATCCTGGCCTTCTTCTTCCGCCTG
CGCACCGACTCGCTCGCCTGGGACACGCTGTACCGCTCTCTTCACTACCAGCTGGCCCCCCTGCGCCGCCCGCTG
CTGTCCTCTACGCGCTACCGGCCGCCCTCGTCGCAGCCCCCTGGCGGCCTGTACAGCCTCGTCTGGGACCCCGTC
TTGCTGACGGTCCGGGCCGCCGTGCCGAACATCCCGGATCAGCAGCCGCGGCTGGAGGCTGACTCGGCGCTTCTC
GATGCCTTTTGGTCGCGTGCTGATGCGGCGAGCACTCATCTTCAGCTGTTGCTTTTGCACGCTGCTACGCGGTCG
CTGACCGGTGCTGTAGAGCGGACGCTGAAGACGAGTCGGGGGTGGTGGATCGTGTGGACTCGTCTTGGGGGACAG
GCGGGTGAGGATGAAGAGATGGAAGCTGCGGCTTCGTCTGTCGATGGCTCTATCGTTGGTCCGGGTGCGGCCAAG
GAGATCTTTCTCGTTCGTCGGGCGAGCGATCATGCTGGTGCGGATGGTGTTGCTGCGGCTGGGATTGGCGTTGAT
ACGCGGCGGTATGTTGAGGAGCTGCTGAGTTTGCTGTAG
Transcript >Ophun1|7172
ATGGCCTCAGCCGCTGCCTCGTCTCCAGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCCATCTACAACCCA
TCGCTGGGCAGCACAGACGATACAGTCGACGACCAGATCGTCTACTACGCCTCCGTCACCACCCAAGCCTCATCA
TCGCGCCGTCGCCGTCGCAGAGACAGAGCAAGGGCACGACCGACCGACGGGCTCGACCCGCAAGAACGCAATGAG
CGTCTGCGCCAGATCGGGCTGGCTCAGGGAATGGTCAGCTTCAGCAGTGGGTTCGCTGACGGGGCTGCCGTCGAT
GCTATTGATACGGACCGCGCTCGTGTCATCGTCCATGAGCTGGAGCCTGGCTGGTGGATCCTGGCCAGCATCGAC
CTGACCAAGCTTCCGCTGCCGCCGCGTCTGAACGCTACGGAAGAATCGTTCGAGTACTCTTCGCGAGAGATGAAG
CCGGCTTCGCTGCTGCTCCGCGATCTGCTTCGCGCACATAGCATCTTCCTCATGCACCACGGCTCGTCCCTCAGC
GCCCTCTTCGTCCACTGCCGCCGCTCCAAGTTCATGGCCTTGCTCGGTCGGTACTGGGATCTGTTCCTGTCGACG
TGGAATGTCCTGCTGCATGGCAATCCGGCCAGGGATATCTTTGGCGCCATCAACGTCGCCGCCTCGGGCGAGCTG
GGCGTTGGCGTCGGCGAAGAGGATCGTGGGAGCGGAGAGCGGGAGGTGCTGGAGGGTTTGGTGGGCAGGATAGAG
GGCTTGGTTGACCTCGTCGTCTCCAAGTTTGGTCCTGACGAGCCGAAGTCTGTTGCTGGGGGGGAGGAGGAGCCC
TGGCTGGGCACGGGTCGGGAGCCGGCGGCTGATGATGGTGCCGTCTTTCTAGGTACGGGAGCGCTGTCGAGGAAG
ACGCTGCGGGATGTGACGCACTGGATGGAGGATCTGTATACCTGGGGTGAGCATGCCTATGGCGTCATTGAGAGT
CCTACGTCGGTTCGACGCAATAAGGCTCGTGGTGCCGTCGGGGAGGCGGCTGAGGGCGAGGTGGCGGGGCCGGGG
CCGGAGCCGGAGCCGGAGCCGGGAGAGGCCAAGACGACGCCGGAAGTGCCGGAGATTAAGATGACGGGACCGACG
GAAGCCGAGACGTCGGAGCCACCAGAGATTAAGACGACGGAACCGACAGAAGCCGAGACGACGTCGGAACCCCCA
GAAACAAAGACTAACCCCCTTCCCTCGCAGCAAGTCGATAACAACAAACCCAGCCAAGATGGCAAGCTGGACAAG
ATGCTCAGCTACATGAAGCTCGGCTACGGCTCCTACTGGAAGCTTCCCGGAGAGTCGACAACGTCCAGCAAGCCC
CCTGCTGTCCGACCAACCCCCCCTCCCCGCGCCTCTTCTGGTCGCGGACGCTTCCTCATCGGCCTCACGGGCGAC
ATGGACGAGGAGCAGGTAACGGCCGGCGACGACGATGGCGACTCCAGCGGCTCTGAGGCGGCTGAGCACAACTCG
CGGACCGTTCTGCGGACGGTGCACGTCGAGATTGAAAGCGGCATGCGACGGCCCGAGACGACCATCGTCAAGGAC
TTTGTCAATCCGGCCAGCGAGCTGACGCAGTCGCAGCTCATGGGCAGCATGTTGTCCGGCTTCGGCTCTCACGAC
GTCAACAAGGCCGACAAGCTACGCGTCGTCATCTACGTCAACCAGCCCTTCATCCTGGCCTTCTTCTTCCGCCTG
CGCACCGACTCGCTCGCCTGGGACACGCTGTACCGCTCTCTTCACTACCAGCTGGCCCCCCTGCGCCGCCCGCTG
CTGTCCTCTACGCGCTACCGGCCGCCCTCGTCGCAGCCCCCTGGCGGCCTGTACAGCCTCGTCTGGGACCCCGTC
TTGCTGACGGTCCGGGCCGCCGTGCCGAACATCCCGGATCAGCAGCCGCGGCTGGAGGCTGACTCGGCGCTTCTC
GATGCCTTTTGGTCGCGTGCTGATGCGGCGAGCACTCATCTTCAGCTGTTGCTTTTGCACGCTGCTACGCGGTCG
CTGACCGGTGCTGTAGAGCGGACGCTGAAGACGAGTCGGGGGTGGTGGATCGTGTGGACTCGTCTTGGGGGACAG
GCGGGTGAGGATGAAGAGATGGAAGCTGCGGCTTCGTCTGTCGATGGCTCTATCGTTGGTCCGGGTGCGGCCAAG
GAGATCTTTCTCGTTCGTCGGGCGAGCGATCATGCTGGTGCGGATGGTGTTGCTGCGGCTGGGATTGGCGTTGAT
ACGCGGCGGTATGTTGAGGAGCTGCTGAGTTTGCTGTAG
Gene >Ophun1|7172
ATGGCCTCAGCCGCTGCCTCGTCTCCAGGGGCCGTCGTCCCCGCCCGCCTCGGCTTCCTAGCCATCTACAACCCA
TCGCTGGGCAGCACAGACGATACAGTCGACGACCAGATCGTCTACTACGCCTCCGTCACCACCCAAGCCTCATCA
TCGCGCCGTCGCCGTCGCAGAGACAGAGCAAGGGCACGACCGACCGACGGGCTCGACCCGCAAGAACGCAATGAG
CGTCTGCGCCAGATCGGGCTGGCTCAGGGAATGGTCAGCTTCAGCAGTGGGTTCGCTGACGGGGCTGCCGTCGAT
GCTATTGATACGGACCGCGCTCGTGTCATCGTCCATGAGCTGGAGCCTGGCTGGTGGATCCTGGCCGTAGGTGTC
AAGGGGATGAGATGGCTCTGTTGCGAGTTCCGTTGACGTCGGGTTTTTTTGGTAGAGCATCGACCTGACCAAGCT
TCCGCTGCCGCCGCGTCTGAACGCTACGGAAGAATCGTTCGAGTACTCTTCGCGAGAGATGAAGCCGGCTTCGCT
GCTGCTCCGCGATCTGCTTCGCGCACATAGCATCTTCCTCATGCACCACGGCTCGTCCCTCAGCGCCCTCTTCGT
CCACTGCCGCCGCTCCAAGTTCATGGCCTTGCTCGGTCGGTACTGGGATCTGTTCCTGTCGACGTGGAATGTCCT
GCTGCATGGCAATCCGGCCAGGGATATCTTTGGCGCCATCAACGTCGCCGCCTCGGGCGAGCTGGGCGTTGGCGT
CGGCGAAGAGGATCGTGGGAGCGGAGAGCGGGAGGTGCTGGAGGGTTTGGTGGGCAGGATAGAGGGCTTGGTTGA
CCTCGTCGTCTCCAAGTTTGGTCCTGACGAGCCGAAGTCTGTTGCTGGGGGGGAGGAGGAGCCCTGGCTGGGCAC
GGGTCGGGAGCCGGCGGCTGATGATGGTGCCGTCTTTCTAGGTACGGGAGCGCTGTCGAGGAAGACGCTGCGGGA
TGTGACGCACTGGATGGAGGATCTGTATACCTGGGGTGAGCATGCCTATGGCGTCATTGAGAGTCCTACGTCGGT
TCGACGCAATAAGGCTCGTGGTGCCGTCGGGGAGGCGGCTGAGGGCGAGGTGGCGGGGCCGGGGCCGGAGCCGGA
GCCGGAGCCGGGAGAGGCCAAGACGACGCCGGAAGTGCCGGAGATTAAGATGACGGGACCGACGGAAGCCGAGAC
GTCGGAGCCACCAGAGATTAAGACGACGGAACCGACAGAAGCCGAGACGACGTCGGAACCCCCAGAAACAAAGAC
TAACCCCCTTCCCTCGCAGCAAGTCGATAACAACAAACCCAGCCAAGATGGCAAGCTGGACAAGATGCTCAGCTA
CATGAAGCTCGGCTACGGCTCCTACTGGAAGCTTCCCGGAGAGTCGACAACGTCCAGCAAGCCCCCTGCTGTCCG
ACCAACCCCCCCTCCCCGCGCCTCTTCTGGTCGCGGACGCTTCCTCATCGGCCTCACGGGCGACATGGACGAGGA
GCAGGTAACGGCCGGCGACGACGATGGCGACTCCAGCGGCTCTGAGGCGGCTGAGCACAACTCGCGGACCGTTCT
GCGGACGGTGCACGTCGAGATTGAAAGCGGCATGCGACGGCCCGAGACGACCATCGTCAAGGACTTTGTCAATCC
GGCCAGCGAGCTGACGCAGTCGCAGCTCATGGGCAGCATGTTGTCCGGCTTCGGCTCTCACGACGTCAACAAGGC
CGACAAGCTACGCGTCGTCATCTACGTCAACCAGCCCTTCATCCTGGCCTTCTTCTTCCGCCTGCGCACCGACTC
GCTCGCCTGGGACACGCTGTACCGCTCTCTTCACTACCAGCTGGCCCCCCTGCGCCGCCCGCTGCTGTCCTCTAC
GCGCTACCGGCCGCCCTCGTCGCAGCCCCCTGGCGGCCTGTACAGCCTCGTCTGGGACCCCGTCTTGCTGACGGT
CCGGGCCGCCGTGCCGAACATCCCGGATCAGCAGCCGCGGCTGGAGGCTGACTCGGCGCTTCTCGATGCCTTTTG
GTCGCGTGCTGATGCGGCGAGCACTCATCTTCAGCTGTTGCTTTTGCACGCTGCTACGCGGTCGCTGACCGGTGC
TGTAGAGCGGACGCTGAAGACGAGTCGGGGGTGGTGGATCGTGTGGACTCGTCTTGGGGGACAGGCGGGTGAGGA
TGAAGAGATGGAAGCTGCGGCTTCGTCTGTCGATGGCTCTATCGTTGGTCCGGGTGCGGCCAAGGAGATCTTTCT
CGTTCGTCGGGCGAGCGATCATGCTGGTGCGGATGGTGTTGCTGCGGCTGGGATTGGCGTTGATACGCGGCGGTA
TGTTGAGGAGCTGCTGAGTTTGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail