Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7171
Gene name
LocationContig_869:46..457
Strand+
Gene length (bp)411
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 37 134 1.0E-16
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 38 136 1.0E-11
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 35 135 2.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1525
Ophiocordyceps australis map64 (Brazil) OphauB2|391
Ophiocordyceps australis map64 (Brazil) OphauB2|7992
Ophiocordyceps camponoti-floridani Ophcf2|01995
Ophiocordyceps camponoti-rufipedis Ophun1|7171 (this protein)
Ophiocordyceps kimflemingae Ophio5|5939
Ophiocordyceps kimflemingae Ophio5|6574
Ophiocordyceps subramaniannii Hirsu2|3974
Ophiocordyceps subramaniannii Hirsu2|6444

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7171
MVIRDRPKPVPAPAPVVPAAQYAESGKQGGYGPGKFSGQITYYTVGMGSCGFDDTGKDQTGNIVAISWAKMGTQS
NGNPMCGQTISIHANGKTVQATVRDKCMGCSENNIDVNEKIFKELFGSLDGGRLPVTWSFN*
Coding >Ophun1|7171
ATGGTAATAAGAGACCGCCCCAAGCCCGTCCCCGCCCCGGCCCCCGTCGTCCCCGCCGCGCAATACGCCGAGAGC
GGCAAGCAAGGCGGCTACGGCCCGGGCAAGTTCAGCGGCCAGATCACCTACTACACCGTCGGCATGGGCTCCTGC
GGCTTCGACGACACGGGCAAGGACCAGACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCC
AACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGGAAGACGGTTCAGGCTACCGTCCGGGAC
AAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGATCTTTAAGGAGCTCTTTGGCAGCCTTGAT
GGCGGCCGCTTGCCCGTTACCTGGTCTTTCAACTAG
Transcript >Ophun1|7171
ATGGTAATAAGAGACCGCCCCAAGCCCGTCCCCGCCCCGGCCCCCGTCGTCCCCGCCGCGCAATACGCCGAGAGC
GGCAAGCAAGGCGGCTACGGCCCGGGCAAGTTCAGCGGCCAGATCACCTACTACACCGTCGGCATGGGCTCCTGC
GGCTTCGACGACACGGGCAAGGACCAGACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCC
AACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGGAAGACGGTTCAGGCTACCGTCCGGGAC
AAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGATCTTTAAGGAGCTCTTTGGCAGCCTTGAT
GGCGGCCGCTTGCCCGTTACCTGGTCTTTCAACTAG
Gene >Ophun1|7171
ATGGTAATAAGAGACCGCCCCAAGCCCGTCCCCGCCCCGGCCCCCGTCGTCCCCGCCGCGCAATACGCCGAGAGC
GGCAAGCAAGGCGGCTACGGCCCGGGCAAGTTCAGCGGCCAGATCACCTACTACACCGTCGGCATGGGCTCCTGC
GGCTTCGACGACACGGGCAAGGACCAGACGGGCAACATCGTGGCCATCTCGTGGGCCAAGATGGGCACCCAATCC
AACGGCAACCCCATGTGCGGCCAGACCATCAGCATCCACGCCAACGGGAAGACGGTTCAGGCTACCGTCCGGGAC
AAGTGCATGGGCTGCTCCGAGAACAACATCGACGTCAATGAAAAGATCTTTAAGGAGCTCTTTGGCAGCCTTGAT
GGCGGCCGCTTGCCCGTTACCTGGTCTTTCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail