Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7166
Gene name
LocationContig_865:785..2991
Strand-
Gene length (bp)2206
Transcript length (bp)2148
Coding sequence length (bp)2148
Protein length (aa) 716

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.5E-02 410 446
PF08238 Sel1 Sel1 repeat 8.1E-06 447 480
PF08238 Sel1 Sel1 repeat 1.7E-01 484 516
PF08238 Sel1 Sel1 repeat 9.3E-05 526 559
PF08238 Sel1 Sel1 repeat 7.1E-04 560 596
PF08238 Sel1 Sel1 repeat 7.1E-04 597 633
PF08238 Sel1 Sel1 repeat 2.8E-05 635 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 317 677 2.0E-82
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 409 715 1.0E-47
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 317 573 2.0E-40
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 317 573 2.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 329 673 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 317 677 2.0E-82
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 409 715 1.0E-47
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 317 573 2.0E-40
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 317 573 2.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 329 673 6.0E-24
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 411 693 8.0E-22
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 407 630 4.0E-19
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 434 689 1.0E-17
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 497 655 9.0E-17
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 425 633 1.0E-12
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 393 680 4.0E-12
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 549 689 8.0E-11
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 549 689 8.0E-11
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 430 612 4.0E-10
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 425 695 8.0E-10
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 430 612 2.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 430 612 1.0E-08
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 524 670 6.0E-08
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 433 667 7.0E-08
sp|Q80TS8|SE1L3_MOUSE Protein sel-1 homolog 3 OS=Mus musculus GN=Sel1l3 PE=2 SV=3 428 680 1.0E-07
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 433 667 2.0E-07
sp|Q68CR1|SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens GN=SEL1L3 PE=1 SV=2 428 680 1.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 429 598 2.0E-06
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 507 686 2.0E-06
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 507 686 2.0E-06
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 507 686 2.0E-06
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 507 686 2.0E-06
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 515 691 3.0E-06
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 433 667 3.0E-06
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 515 680 4.0E-06
sp|Q94C27|FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana GN=At1g70590 PE=2 SV=1 529 686 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4454
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1849
Ophiocordyceps australis map64 (Brazil) OphauB2|3046
Ophiocordyceps camponoti-floridani Ophcf2|04403
Ophiocordyceps camponoti-rufipedis Ophun1|7166 (this protein)
Ophiocordyceps kimflemingae Ophio5|3133
Ophiocordyceps subramaniannii Hirsu2|9245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7166
MAASPVSEGLNHGALLARPSATRPAQDLPRKHLLLPPSTARLRDAPVSPVRVNIQRENWPQPSNADIELAQSQAA
RLSIADEPHELPVAAEPPPSELAAAVAIEFEQTALNLDLAPTSPVEQSKSNVGTRNSRESDESTGSDRQRGSDTP
SAHTSASSVSGAVECPPGDSPTRGSDSRNYTTPLFQYHHEQIPHAPTRVSSVPSESARSASNPDLVDGAMAPPRR
HLTPTSGYWPRGSPLSRPQSSYSTVSDMGPRGRSPNLLAGGSHMRAPSAASRRSPDVRPSSYAEMLSVPYPQQAP
PAALALDNSSLRTVVGNNASLLSVEKTLEMYRQNVKKTNDFSIQYSFAVYLVSLAQEQGFDMADLKPRKGGRQAD
GECPEAESPVAHSTYELVREARQILQRLANGGYPFAQYYLADGHASGLFSKGKEDYNSAFPLFVLAAKHGHAESA
YRTALCYEFGWGCRKDPAKAVQFLRSAASKRHPGAMTRLGKACLSGDLGEKRYREGVKWMKLATEAADAQYNAAP
YQLGCLYETGYGDDVFQDLGYAAELFTQAAELGHPEANFRMGDAYEHGRLNCPRDPALSVHFYTGAAEGGHAAAM
MGLCAWYMVGAAPILDKDEEEAYEWARRSAELGFAKAQYAVGYFTEFGIGCRRDMLEANVWYVKAADAGDDRAKQ
RLSVIQAAASGQQVTTPEGGRPRSGKLAKTAKDDKECVVM*
Coding >Ophun1|7166
ATGGCCGCATCACCCGTCAGCGAAGGCCTCAACCATGGCGCTCTACTCGCCAGGCCTTCCGCCACCAGGCCTGCC
CAAGACCTTCCCAGGAAGCATCTGCTCCTCCCGCCCAGCACCGCCAGACTGAGAGACGCGCCCGTCTCGCCCGTC
CGGGTCAACATCCAGCGCGAGAACTGGCCTCAGCCGTCCAACGCCGACATCGAGCTCGCCCAGTCCCAGGCCGCC
CGCCTCAGCATCGCCGACGAGCCCCATGAGCTGCCAGTCGCTGCCGAGCCGCCGCCCTCAGAGTTGGCAGCCGCA
GTCGCCATAGAGTTCGAGCAGACGGCGCTTAACCTCGACCTTGCCCCAACGTCGCCCGTTGAGCAGAGCAAAAGC
AACGTCGGCACCCGAAACAGCCGCGAGTCGGACGAATCGACCGGCAGCGACCGGCAGCGAGGCTCCGACACGCCC
TCGGCCCATACCAGCGCCAGCTCCGTCTCCGGTGCCGTCGAGTGCCCGCCCGGCGATTCCCCGACCAGAGGCAGC
GATTCCCGAAACTATACAACTCCCCTCTTCCAGTATCACCACGAGCAGATTCCCCATGCCCCGACGCGCGTCAGC
AGCGTGCCCAGCGAATCGGCGCGCTCGGCGTCGAACCCGGACCTCGTCGACGGCGCCATGGCACCGCCCAGACGA
CACCTGACACCGACGTCGGGATACTGGCCCAGAGGGTCCCCCCTGTCGCGGCCGCAGTCTTCGTACTCGACCGTG
TCCGACATGGGCCCCCGCGGCCGGTCTCCGAACCTGCTGGCGGGCGGCTCCCACATGCGCGCCCCTTCGGCGGCG
TCGCGCAGGTCGCCCGACGTCCGGCCGTCGTCGTACGCAGAGATGCTCAGCGTCCCATACCCGCAACAGGCGCCG
CCCGCGGCCTTAGCCCTGGACAACTCGAGCCTGCGGACGGTGGTGGGCAACAACGCGTCGCTGCTGAGCGTGGAA
AAGACGCTCGAGATGTACCGGCAAAACGTCAAGAAGACCAACGACTTTTCCATCCAGTACTCGTTCGCCGTCTAC
CTGGTCTCGCTGGCGCAGGAGCAAGGCTTCGACATGGCGGACCTGAAGCCGCGCAAGGGCGGGCGACAGGCCGAC
GGCGAGTGTCCCGAGGCCGAGAGCCCCGTGGCTCACAGCACGTACGAGCTGGTGCGGGAGGCGCGGCAGATCTTG
CAGCGTCTCGCCAACGGAGGTTACCCGTTCGCGCAATACTACTTGGCCGACGGGCACGCGTCGGGCCTGTTCAGC
AAGGGCAAGGAAGACTATAACTCGGCCTTTCCGCTGTTCGTGCTGGCGGCCAAGCACGGGCACGCCGAGTCGGCT
TACCGGACGGCGCTGTGCTACGAGTTCGGCTGGGGCTGCCGCAAGGACCCGGCCAAGGCGGTGCAGTTCCTGCGG
TCGGCGGCCTCGAAGCGGCATCCGGGGGCCATGACGCGGCTGGGCAAGGCGTGCCTCTCGGGCGACCTGGGGGAG
AAGAGGTACCGCGAGGGCGTCAAGTGGATGAAGCTGGCGACCGAGGCGGCGGACGCGCAGTACAACGCGGCGCCC
TACCAGCTGGGCTGCCTGTACGAGACGGGATACGGCGACGACGTGTTCCAGGACCTCGGTTACGCGGCCGAACTG
TTTACGCAGGCGGCCGAGCTGGGCCATCCGGAGGCCAACTTCAGGATGGGCGACGCCTACGAGCACGGGCGGCTC
AACTGCCCGCGAGACCCGGCCCTGAGCGTCCACTTCTATACGGGTGCCGCCGAGGGAGGGCACGCGGCGGCCATG
ATGGGGCTCTGCGCCTGGTACATGGTAGGGGCCGCGCCGATACTGGACAAGGACGAGGAGGAGGCGTACGAGTGG
GCGCGACGGTCCGCCGAGCTGGGCTTCGCCAAGGCGCAGTACGCCGTCGGCTACTTTACAGAGTTTGGCATCGGC
TGCCGGCGCGACATGCTCGAGGCCAACGTCTGGTACGTCAAGGCGGCCGATGCCGGCGACGATCGAGCCAAGCAG
CGACTGTCGGTCATCCAGGCGGCGGCCAGCGGCCAGCAAGTGACGACGCCCGAGGGAGGCCGGCCCCGGAGCGGA
AAGCTGGCCAAGACGGCCAAAGACGACAAGGAGTGTGTCGTCATGTGA
Transcript >Ophun1|7166
ATGGCCGCATCACCCGTCAGCGAAGGCCTCAACCATGGCGCTCTACTCGCCAGGCCTTCCGCCACCAGGCCTGCC
CAAGACCTTCCCAGGAAGCATCTGCTCCTCCCGCCCAGCACCGCCAGACTGAGAGACGCGCCCGTCTCGCCCGTC
CGGGTCAACATCCAGCGCGAGAACTGGCCTCAGCCGTCCAACGCCGACATCGAGCTCGCCCAGTCCCAGGCCGCC
CGCCTCAGCATCGCCGACGAGCCCCATGAGCTGCCAGTCGCTGCCGAGCCGCCGCCCTCAGAGTTGGCAGCCGCA
GTCGCCATAGAGTTCGAGCAGACGGCGCTTAACCTCGACCTTGCCCCAACGTCGCCCGTTGAGCAGAGCAAAAGC
AACGTCGGCACCCGAAACAGCCGCGAGTCGGACGAATCGACCGGCAGCGACCGGCAGCGAGGCTCCGACACGCCC
TCGGCCCATACCAGCGCCAGCTCCGTCTCCGGTGCCGTCGAGTGCCCGCCCGGCGATTCCCCGACCAGAGGCAGC
GATTCCCGAAACTATACAACTCCCCTCTTCCAGTATCACCACGAGCAGATTCCCCATGCCCCGACGCGCGTCAGC
AGCGTGCCCAGCGAATCGGCGCGCTCGGCGTCGAACCCGGACCTCGTCGACGGCGCCATGGCACCGCCCAGACGA
CACCTGACACCGACGTCGGGATACTGGCCCAGAGGGTCCCCCCTGTCGCGGCCGCAGTCTTCGTACTCGACCGTG
TCCGACATGGGCCCCCGCGGCCGGTCTCCGAACCTGCTGGCGGGCGGCTCCCACATGCGCGCCCCTTCGGCGGCG
TCGCGCAGGTCGCCCGACGTCCGGCCGTCGTCGTACGCAGAGATGCTCAGCGTCCCATACCCGCAACAGGCGCCG
CCCGCGGCCTTAGCCCTGGACAACTCGAGCCTGCGGACGGTGGTGGGCAACAACGCGTCGCTGCTGAGCGTGGAA
AAGACGCTCGAGATGTACCGGCAAAACGTCAAGAAGACCAACGACTTTTCCATCCAGTACTCGTTCGCCGTCTAC
CTGGTCTCGCTGGCGCAGGAGCAAGGCTTCGACATGGCGGACCTGAAGCCGCGCAAGGGCGGGCGACAGGCCGAC
GGCGAGTGTCCCGAGGCCGAGAGCCCCGTGGCTCACAGCACGTACGAGCTGGTGCGGGAGGCGCGGCAGATCTTG
CAGCGTCTCGCCAACGGAGGTTACCCGTTCGCGCAATACTACTTGGCCGACGGGCACGCGTCGGGCCTGTTCAGC
AAGGGCAAGGAAGACTATAACTCGGCCTTTCCGCTGTTCGTGCTGGCGGCCAAGCACGGGCACGCCGAGTCGGCT
TACCGGACGGCGCTGTGCTACGAGTTCGGCTGGGGCTGCCGCAAGGACCCGGCCAAGGCGGTGCAGTTCCTGCGG
TCGGCGGCCTCGAAGCGGCATCCGGGGGCCATGACGCGGCTGGGCAAGGCGTGCCTCTCGGGCGACCTGGGGGAG
AAGAGGTACCGCGAGGGCGTCAAGTGGATGAAGCTGGCGACCGAGGCGGCGGACGCGCAGTACAACGCGGCGCCC
TACCAGCTGGGCTGCCTGTACGAGACGGGATACGGCGACGACGTGTTCCAGGACCTCGGTTACGCGGCCGAACTG
TTTACGCAGGCGGCCGAGCTGGGCCATCCGGAGGCCAACTTCAGGATGGGCGACGCCTACGAGCACGGGCGGCTC
AACTGCCCGCGAGACCCGGCCCTGAGCGTCCACTTCTATACGGGTGCCGCCGAGGGAGGGCACGCGGCGGCCATG
ATGGGGCTCTGCGCCTGGTACATGGTAGGGGCCGCGCCGATACTGGACAAGGACGAGGAGGAGGCGTACGAGTGG
GCGCGACGGTCCGCCGAGCTGGGCTTCGCCAAGGCGCAGTACGCCGTCGGCTACTTTACAGAGTTTGGCATCGGC
TGCCGGCGCGACATGCTCGAGGCCAACGTCTGGTACGTCAAGGCGGCCGATGCCGGCGACGATCGAGCCAAGCAG
CGACTGTCGGTCATCCAGGCGGCGGCCAGCGGCCAGCAAGTGACGACGCCCGAGGGAGGCCGGCCCCGGAGCGGA
AAGCTGGCCAAGACGGCCAAAGACGACAAGGAGTGTGTCGTCATGTGA
Gene >Ophun1|7166
ATGGCCGCATCACCCGTCAGCGAAGGCCTCAACCATGGCGCTCTACTCGCCAGGCCTTCCGCCACCAGGCCTGCC
CAAGACCTTCCCAGGAAGCATCTGCTCCTCCCGCCCAGCACCGCCAGACTGAGAGACGCGCCCGTCTCGCCCGTC
CGGGTCAACATCCAGCGCGAGAACTGGCCTCAGCCGTCCAACGCCGACATCGAGCTCGCCCAGTCCCAGGCCGCC
CGCCTCAGCATCGCCGACGAGCCCCATGAGCTGCCAGTCGCTGCCGAGCCGCCGCCCTCAGAGTTGGCAGCCGCA
GTCGCCATAGAGTTCGAGCAGACGGCGCTTAACCTCGACCTTGCCCCAACGTCGCCCGTTGAGCAGAGCAAAAGC
AACGTCGGCACCCGAAACAGCCGCGAGTCGGACGAATCGACCGGCAGCGACCGGCAGCGAGGCTCCGACACGCCC
TCGGCCCATACCAGCGCCAGCTCCGTCTCCGGTGCCGTCGAGTGCCCGCCCGGCGATTCCCCGACCAGAGGCAGC
GATTCCCGAAACTATACAACTCCCCTCTTCCAGTATCACCACGAGCAGATTCCCCATGCCCCGACGCGCGTCAGC
AGCGTGCCCAGCGAATCGGCGCGCTCGGCGTCGAACCCGGACCTCGTCGACGGCGCCATGGCACCGCCCAGACGA
CACCTGACACCGACGTCGGGATACTGGCCCAGAGGGTCCCCCCTGTCGCGGCCGCAGTCTTCGTACTCGACCGTG
TCCGACATGGGCCCCCGCGGCCGGTCTCCGAACCTGCTGGCGGGCGGCTCCCACATGCGCGCCCCTTCGGCGGCG
TCGCGCAGGTCGCCCGACGTCCGGCCGTCGTCGTACGCAGAGATGCTCAGCGTCCCATACCCGCAACAGGCGCCG
CCCGCGGCCTTAGCCCTGGACAACTCGAGCCTGCGGACGGTGGTGGGCAACAACGCGTCGCTGCTGAGCGTGGAA
AAGACGCTCGAGATGTACCGGCAAAACGTCAAGAAGACCAACGACTTTTCCATCCAGTACTCGTTCGCCGTCTAC
CTGGTCTCGCTGGCGCAGGAGCAAGGCTTCGACATGGCGGACCTGAAGCCGCGCAAGGGCGGGCGACAGGCCGAC
GGCGAGTGTCCCGAGGCCGAGAGCCCCGTGGCTCACAGCACGTACGAGCTGGTGCGGGAGGCGCGGCAGATCTTG
CAGCGTCTCGCCAACGGAGGTTACCCGTTCGCGCAATACTACTTGGCCGACGGGCACGCGTCGGGCCTGTTCAGC
AAGGGCAAGGAAGACTATAACTCGGCCTTTCCGCTGTTCGTGCTGGCGGCCAAGCACGGGCACGCCGAGTCGGCT
TACCGGACGGCGCTGTGCTACGAGTTCGGCTGGGGCTGCCGCAAGGACCCGGCCAAGGCGGTGCAGTTCCTGCGG
TCGGCGGCCTCGAAGCGGCATCCGGGGGCCATGACGCGGCTGGGCAAGGCGTGCCTCTCGGGCGACCTGGGGGAG
AAGAGGTACCGCGAGGGCGTCAAGTGGATGAAGCTGGCGACCGAGGCGGCGGACGCGCAGTACAACGCGGCGCCC
TACCAGCTGGGCTGCCTGTACGAGACGGGATACGGCGACGACGTGTTCCAGGACCTCGGTTACGCGGCCGAACTG
TTTACGCAGGCGGCCGAGCTGGGCCATCCGGAGGCCAACTTCAGGATGGGCGACGCCTACGAGCACGGGCGGCTC
AACTGCCCGCGAGACCCGGCCCTGAGCGTCCACTTCTATACGGGTGCCGCCGAGGGAGGGCACGCGGCGGCCATG
ATGGGGCTCTGCGCCTGGTACATGGTAGGGGCCGCGCCGATACTGGACAAGGACGAGGAGGAGGCGTACGAGTGG
GCGCGACGGTCCGCCGAGCTGGGTGAGTCGTTTGCCTCCCTTGACAAGGGATGACGATGCTGACTCGAGCCAACC
TGCAGGCTTCGCCAAGGCGCAGTACGCCGTCGGCTACTTTACAGAGTTTGGCATCGGCTGCCGGCGCGACATGCT
CGAGGCCAACGTCTGGTACGTCAAGGCGGCCGATGCCGGCGACGATCGAGCCAAGCAGCGACTGTCGGTCATCCA
GGCGGCGGCCAGCGGCCAGCAAGTGACGACGCCCGAGGGAGGCCGGCCCCGGAGCGGAAAGCTGGCCAAGACGGC
CAAAGACGACAAGGAGTGTGTCGTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail