Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7161
Gene name
LocationContig_863:1840..3394
Strand-
Gene length (bp)1554
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 2.3E-07 231 492

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9GUC9|YFEF9_CAEEL Uncharacterized protein F14F9.5 OS=Caenorhabditis elegans GN=F14F9.5 PE=1 SV=2 228 499 4.0E-39

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.99961

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4370
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5833
Ophiocordyceps australis map64 (Brazil) OphauB2|4116
Ophiocordyceps camponoti-floridani Ophcf2|04534
Ophiocordyceps camponoti-rufipedis Ophun1|7161 (this protein)
Ophiocordyceps kimflemingae Ophio5|2459
Ophiocordyceps subramaniannii Hirsu2|9024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7161
MRSSSSYVTSGLTALFLLISGASTAPTASDGSLSWSDADPLFTFRYSTSQPDSKNWIGLYNSFYGAPENESYVAN
SLAWSYAPDDHGSVKVTPPKNLPPGLYRAFLLAHNGYQHLADPVDVVFGNGSLSFLVDEFTTRNGREGDAFNVSI
KGLLTNQKDTKTKFTKMTSEGDGDDWVTVSEDGTISGKPEASGERRVTIEATSSVGSKAQLKVKIPIRSSGTPLV
DRIGVLSFNMWHGGTQVNDYHRKQVRYLTSSNVDIVGLQESSGGHAVRLAQALGWDSWQGSDVGIISRYPIVERF
EPTRAGGAVRIALDGDASQIIAWNAHLGYTPYGPYDFCYDHMTVEEVMKNEAVSGRTPQIVEIMDRMKSHIANSE
RVPVLLTGDMNAPSHLDWTEATRSQHCNVGTVPWPSSEEPIKGGLIDSYREVHKDPAADPGITWSPIQLENDGRP
EPLDRIDFVYHKGLKVVDSVREVVGKPQAEPNHWDNEWTTDHAAVRSTFQVPAKQEKRDVVREALKI*
Coding >Ophun1|7161
ATGCGGTCTTCATCGTCCTACGTGACATCCGGCTTGACGGCCCTCTTCCTCCTCATCAGCGGAGCCTCTACAGCC
CCGACGGCTTCGGACGGCTCCCTCTCTTGGTCCGACGCTGACCCTCTCTTCACCTTTCGCTATTCGACGTCGCAA
CCCGATAGCAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGAGAATGAGTCGTACGTGGCCAAC
TCGCTGGCTTGGTCCTACGCTCCGGACGACCATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTGCCTCCGGGC
CTGTACCGCGCTTTTCTCCTCGCCCACAACGGCTACCAGCATCTCGCGGATCCCGTCGACGTCGTCTTTGGTAAT
GGATCTTTGTCGTTTCTCGTTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCAATGTCAGCATC
AAAGGCCTCCTTACCAACCAAAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGCGATGGCGACGAT
TGGGTCACCGTGTCCGAAGATGGAACCATCAGCGGCAAGCCTGAAGCCAGCGGCGAGAGACGCGTCACCATCGAG
GCAACCAGCTCCGTCGGATCCAAGGCTCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCACGCCTCTGGTC
GACCGTATCGGCGTCTTATCCTTCAACATGTGGCACGGCGGCACGCAGGTCAACGACTACCACCGTAAGCAGGTC
CGCTATCTGACCAGCAGCAACGTCGACATTGTCGGTCTGCAGGAGAGCAGCGGTGGACACGCAGTAAGACTCGCT
CAGGCGCTGGGCTGGGACTCGTGGCAGGGCTCAGACGTCGGCATCATCAGCCGCTACCCCATTGTCGAGAGATTC
GAGCCGACGCGAGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCCTGGAACGCC
CACCTGGGATATACGCCGTACGGACCGTACGACTTTTGCTACGACCACATGACGGTCGAGGAAGTCATGAAGAAC
GAGGCCGTGTCCGGGCGAACGCCGCAGATTGTCGAGATCATGGACCGCATGAAGTCGCACATCGCCAACTCGGAA
CGTGTCCCGGTACTGCTCACGGGCGACATGAACGCGCCCTCTCATCTTGACTGGACCGAGGCAACGCGAAGCCAG
CACTGCAACGTCGGGACCGTGCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGAGGCCTCATAGACTCGTACCGC
GAGGTTCACAAGGACCCAGCCGCCGACCCTGGCATCACCTGGTCTCCCATCCAGCTGGAGAATGATGGCCGGCCC
GAGCCGCTGGACCGTATCGACTTTGTCTATCACAAGGGGCTGAAGGTGGTCGACTCGGTGCGTGAGGTGGTTGGA
AAGCCGCAGGCGGAGCCCAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCGACGTTTCAG
GTGCCGGCCAAGCAGGAGAAGCGCGATGTGGTTCGAGAGGCGCTGAAGATTTAG
Transcript >Ophun1|7161
ATGCGGTCTTCATCGTCCTACGTGACATCCGGCTTGACGGCCCTCTTCCTCCTCATCAGCGGAGCCTCTACAGCC
CCGACGGCTTCGGACGGCTCCCTCTCTTGGTCCGACGCTGACCCTCTCTTCACCTTTCGCTATTCGACGTCGCAA
CCCGATAGCAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGAGAATGAGTCGTACGTGGCCAAC
TCGCTGGCTTGGTCCTACGCTCCGGACGACCATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTGCCTCCGGGC
CTGTACCGCGCTTTTCTCCTCGCCCACAACGGCTACCAGCATCTCGCGGATCCCGTCGACGTCGTCTTTGGTAAT
GGATCTTTGTCGTTTCTCGTTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCAATGTCAGCATC
AAAGGCCTCCTTACCAACCAAAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGCGATGGCGACGAT
TGGGTCACCGTGTCCGAAGATGGAACCATCAGCGGCAAGCCTGAAGCCAGCGGCGAGAGACGCGTCACCATCGAG
GCAACCAGCTCCGTCGGATCCAAGGCTCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCACGCCTCTGGTC
GACCGTATCGGCGTCTTATCCTTCAACATGTGGCACGGCGGCACGCAGGTCAACGACTACCACCGTAAGCAGGTC
CGCTATCTGACCAGCAGCAACGTCGACATTGTCGGTCTGCAGGAGAGCAGCGGTGGACACGCAGTAAGACTCGCT
CAGGCGCTGGGCTGGGACTCGTGGCAGGGCTCAGACGTCGGCATCATCAGCCGCTACCCCATTGTCGAGAGATTC
GAGCCGACGCGAGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCCTGGAACGCC
CACCTGGGATATACGCCGTACGGACCGTACGACTTTTGCTACGACCACATGACGGTCGAGGAAGTCATGAAGAAC
GAGGCCGTGTCCGGGCGAACGCCGCAGATTGTCGAGATCATGGACCGCATGAAGTCGCACATCGCCAACTCGGAA
CGTGTCCCGGTACTGCTCACGGGCGACATGAACGCGCCCTCTCATCTTGACTGGACCGAGGCAACGCGAAGCCAG
CACTGCAACGTCGGGACCGTGCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGAGGCCTCATAGACTCGTACCGC
GAGGTTCACAAGGACCCAGCCGCCGACCCTGGCATCACCTGGTCTCCCATCCAGCTGGAGAATGATGGCCGGCCC
GAGCCGCTGGACCGTATCGACTTTGTCTATCACAAGGGGCTGAAGGTGGTCGACTCGGTGCGTGAGGTGGTTGGA
AAGCCGCAGGCGGAGCCCAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCGACGTTTCAG
GTGCCGGCCAAGCAGGAGAAGCGCGATGTGGTTCGAGAGGCGCTGAAGATTTAG
Gene >Ophun1|7161
ATGCGGTCTTCATCGTCCTACGTGACATCCGGCTTGACGGCCCTCTTCCTCCTCATCAGCGGAGCCTCTACAGCC
CCGACGGCTTCGGACGGCTCCCTCTCTTGGTCCGACGCTGACCCTCTCTTCACCTTTCGCTATTCGACGTCGCAA
CCCGATAGCAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGAGAATGAGTCGTACGTGGCCAAC
TCGCTGGCTTGGTCCTACGCTCCGGACGACCATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTGCCTCCGGGC
CTGTACCGCGCTTTTCTCCTCGCCCACAACGGCTACCAGCATCTCGCGGATCCCGTCGACGTCGTCTTTGGTAAT
GGATCTTTGTCGTTTCTCGTTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCAATGTCAGCATC
AAAGGCCTCCTTACCAACCAAAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGCGATGGCGACGAT
TGGGTCACCGTGTCCGAAGATGGAACCATCAGCGGCAAGCCTGAAGCCAGCGGCGAGAGACGCGTCACCATCGAG
GCAACCAGCTCCGTCGGATCCAAGGCTCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCACGCCTCTGGTC
GACCGTATCGGCGTCTTATCCTTCAACATGTGGCACGGCGGCACGCAGGTCAACGACTACCACCGTAAGCAGGTC
CGCTATCTGACCAGCAGCAACGTCGACATTGTCGGTCTGCAGGAGAGCAGCGGTGGACACGCAGTAAGACTCGCT
CAGGCGCTGGGCTGGGACTCGTGGCAGGGCTCAGACGTCGGCATCATCAGCCGCTACCCCATTGTCGAGAGATTC
GAGCCGACGCGAGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCCTGGAACGCC
CACCTGGGATATACGCCGTACGGACCGTACGACTTTTGCTACGACCACATGACGGTCGAGGAAGTCATGAAGAAC
GAGGCCGTGTCCGGGCGAACGCCGCAGATTGTCGAGATCATGGACCGCATGAAGTCGCACATCGCCAACTCGGAA
CGTGTCCCGGTACTGCTCACGGGCGACATGAACGCGCCCTCTCATCTTGACTGGACCGAGGCAACGCGAAGCCAG
CACTGCAACGTCGGGACCGTGCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGAGGCCTCATAGACTCGTACCGC
GAGGTTCACAAGGACCCAGCCGCCGACCCTGGCATCACCTGGTCTCCCATCCAGCTGGAGAATGATGGCCGGCCC
GAGCCGCTGGACCGTATCGACTTTGTCTATCACAAGGGGCTGAAGGTGGTCGACTCGGTGCGTGAGGTGGTTGGA
AAGCCGCAGGCGGAGCCCAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCGACGTTTCAG
GTGCCGGCCAAGCAGGAGAAGCGCGATGTGGTTCGAGAGGCGCTGAAGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail