Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7159
Gene name
LocationContig_862:2194..4005
Strand-
Gene length (bp)1811
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01798 Nop snoRNA binding domain, fibrillarin 8.6E-75 121 361
PF09785 Prp31_C Prp31 C terminal domain 6.4E-47 368 515

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42904|PRP31_SCHPO Pre-mRNA-processing factor 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp31 PE=3 SV=1 97 541 1.0E-94
sp|Q8CCF0|PRP31_MOUSE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Mus musculus GN=Prpf31 PE=1 SV=3 77 541 9.0E-93
sp|Q6NVP6|PRP31_XENTR U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus tropicalis GN=prpf31 PE=2 SV=1 100 541 1.0E-89
sp|Q5U5C5|PRP31_XENLA U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus laevis GN=prpf31 PE=2 SV=1 42 541 3.0E-88
sp|Q7SXM7|PRP31_DANRE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Danio rerio GN=prpf31 PE=2 SV=1 3 541 1.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42904|PRP31_SCHPO Pre-mRNA-processing factor 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp31 PE=3 SV=1 97 541 1.0E-94
sp|Q8CCF0|PRP31_MOUSE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Mus musculus GN=Prpf31 PE=1 SV=3 77 541 9.0E-93
sp|Q6NVP6|PRP31_XENTR U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus tropicalis GN=prpf31 PE=2 SV=1 100 541 1.0E-89
sp|Q5U5C5|PRP31_XENLA U4/U6 small nuclear ribonucleoprotein Prp31 OS=Xenopus laevis GN=prpf31 PE=2 SV=1 42 541 3.0E-88
sp|Q7SXM7|PRP31_DANRE U4/U6 small nuclear ribonucleoprotein Prp31 OS=Danio rerio GN=prpf31 PE=2 SV=1 3 541 1.0E-86
sp|Q8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 OS=Homo sapiens GN=PRPF31 PE=1 SV=2 77 541 2.0E-86
sp|P49704|PRP31_YEAST Pre-mRNA-processing factor 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP31 PE=1 SV=2 112 431 4.0E-57
sp|Q4PBF2|NOP58_USTMA Nucleolar protein 58 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NOP58 PE=3 SV=1 111 407 2.0E-26
sp|P0CP27|NOP58_CRYNB Nucleolar protein 58 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NOP58 PE=3 SV=1 111 347 3.0E-25
sp|P0CP26|NOP58_CRYNJ Nucleolar protein 58 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NOP58 PE=3 SV=1 111 347 3.0E-25
sp|Q9MAB3|NOP5B_ARATH Probable nucleolar protein 5-2 OS=Arabidopsis thaliana GN=NOP5-2 PE=2 SV=1 110 362 5.0E-25
sp|Q1E1Q5|NOP58_COCIM Nucleolar protein 58 OS=Coccidioides immitis (strain RS) GN=NOP58 PE=3 SV=1 79 350 9.0E-23
sp|O04658|NOP5A_ARATH Probable nucleolar protein 5-1 OS=Arabidopsis thaliana GN=NOP5-1 PE=2 SV=2 110 362 1.0E-22
sp|Q55FI4|NOP58_DICDI Nucleolar protein 58 OS=Dictyostelium discoideum GN=nop58 PE=3 SV=1 78 358 4.0E-22
sp|Q9P7S7|NOP58_SCHPO Nucleolar protein 58 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop58 PE=1 SV=1 111 377 5.0E-22
sp|Q21276|YZVL_CAEEL Uncharacterized NOP5 family protein K07C5.4 OS=Caenorhabditis elegans GN=K07C5.4 PE=3 SV=1 111 363 8.0E-22
sp|Q0CQH1|NOP58_ASPTN Nucleolar protein 58 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nop58 PE=3 SV=1 79 401 8.0E-22
sp|A1CL70|NOP58_ASPCL Nucleolar protein 58 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop58 PE=3 SV=1 79 347 8.0E-22
sp|O00567|NOP56_HUMAN Nucleolar protein 56 OS=Homo sapiens GN=NOP56 PE=1 SV=4 111 359 9.0E-22
sp|Q5RA29|NOP56_PONAB Nucleolar protein 56 OS=Pongo abelii GN=NOP56 PE=2 SV=1 111 359 1.0E-21
sp|A1D688|NOP58_NEOFI Nucleolar protein 58 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nop58 PE=3 SV=1 78 347 2.0E-21
sp|Q4WYK9|NOP58_ASPFU Nucleolar protein 58 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop58 PE=3 SV=1 78 347 2.0E-21
sp|O94514|NOP56_SCHPO Nucleolar protein 56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop56 PE=3 SV=1 111 359 4.0E-21
sp|A6QYH8|NOP58_AJECN Nucleolar protein 58 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NOP58 PE=3 SV=1 79 339 1.0E-20
sp|O04656|NOP5C_ARATH Putative nucleolar protein 5-3 OS=Arabidopsis thaliana GN=NOP5-3 PE=3 SV=2 110 362 1.0E-20
sp|Q5B8G3|NOP58_EMENI Nucleolar protein 58 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop58 PE=3 SV=1 79 347 2.0E-20
sp|Q2UC04|NOP58_ASPOR Nucleolar protein 58 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nop58 PE=3 SV=1 111 339 2.0E-20
sp|A2QE38|NOP58_ASPNC Nucleolar protein 58 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nop58 PE=3 SV=1 78 385 2.0E-20
sp|A6RMY5|NOP58_BOTFB Nucleolar protein 58 OS=Botryotinia fuckeliana (strain B05.10) GN=nop58 PE=3 SV=1 111 355 1.0E-19
sp|A7F2R6|NOP58_SCLS1 Nucleolar protein 58 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=NOP58 PE=3 SV=1 111 355 3.0E-19
sp|Q95K50|NOP56_MACFA Nucleolar protein 56 OS=Macaca fascicularis GN=NOP56 PE=2 SV=1 111 359 4.0E-19
sp|Q9QZ86|NOP58_RAT Nucleolar protein 58 OS=Rattus norvegicus GN=Nop58 PE=1 SV=1 111 362 4.0E-19
sp|Q9Y2X3|NOP58_HUMAN Nucleolar protein 58 OS=Homo sapiens GN=NOP58 PE=1 SV=1 111 362 4.0E-19
sp|Q4R779|NOP58_MACFA Nucleolar protein 58 OS=Macaca fascicularis GN=NOP58 PE=2 SV=1 68 362 5.0E-19
sp|Q9D6Z1|NOP56_MOUSE Nucleolar protein 56 OS=Mus musculus GN=Nop56 PE=1 SV=2 111 359 5.0E-19
sp|Q6DFW4|NOP58_MOUSE Nucleolar protein 58 OS=Mus musculus GN=Nop58 PE=1 SV=1 111 362 6.0E-19
sp|A7TIF5|NOP58_VANPO Nucleolar protein 58 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NOP58 PE=3 SV=1 112 362 1.0E-18
sp|Q3SZ63|NOP56_BOVIN Nucleolar protein 56 OS=Bos taurus GN=NOP56 PE=2 SV=1 111 359 2.0E-18
sp|Q6CG46|NOP58_YARLI Nucleolar protein 58 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP58 PE=3 SV=1 111 337 4.0E-18
sp|Q12460|NOP56_YEAST Nucleolar protein 56 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP56 PE=1 SV=1 113 367 4.0E-18
sp|Q8X066|NOP58_NEUCR Nucleolar protein 58 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-58 PE=3 SV=1 112 339 7.0E-18
sp|A5E4V9|NOP58_LODEL Nucleolar protein 58 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NOP58 PE=3 SV=1 111 337 9.0E-18
sp|Q6CKR8|NOP58_KLULA Nucleolar protein 58 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP58 PE=3 SV=1 112 362 3.0E-17
sp|Q59S06|NOP58_CANAL Nucleolar protein 58 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP58 PE=3 SV=1 79 337 3.0E-17
sp|Q12499|NOP58_YEAST Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP58 PE=1 SV=1 112 362 5.0E-17
sp|A6ZPE5|NOP58_YEAS7 Nucleolar protein 58 OS=Saccharomyces cerevisiae (strain YJM789) GN=NOP58 PE=3 SV=1 112 362 5.0E-17
sp|Q54MT2|NOP56_DICDI Nucleolar protein 56 OS=Dictyostelium discoideum GN=nop56 PE=3 SV=1 107 360 5.0E-17
sp|A5DHW0|NOP58_PICGU Nucleolar protein 58 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NOP58 PE=3 SV=2 111 311 7.0E-17
sp|Q753I4|NOP58_ASHGO Nucleolar protein 58 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP58 PE=3 SV=2 112 362 1.0E-16
sp|Q58105|Y694_METJA Uncharacterized NOP5 family protein MJ0694 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0694 PE=1 SV=1 123 364 2.0E-16
sp|A3LUT0|NOP58_PICST Nucleolar protein 58 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NOP58 PE=3 SV=1 111 311 9.0E-16
sp|Q6BIX6|NOP58_DEBHA Nucleolar protein 58 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP58 PE=3 SV=2 79 311 1.0E-15
sp|Q6FQ21|NOP58_CANGA Nucleolar protein 58 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP58 PE=3 SV=1 112 311 1.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2062
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|917
Ophiocordyceps australis map64 (Brazil) OphauB2|2594
Ophiocordyceps camponoti-floridani Ophcf2|00156
Ophiocordyceps camponoti-rufipedis Ophun1|7159 (this protein)
Ophiocordyceps kimflemingae Ophio5|633
Ophiocordyceps subramaniannii Hirsu2|2378

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7159
MSTIVDELLNDFGDSGDEQSEPLQDLADPEKEDEGAEDAMDVDDDDDAHAAKDMHELEDAEATKARVEKMKLGAV
KDVRSVASLMQTLEPVLEASVQTVTVGNIEDHPEYSLLTQSNSLSTMIDGEVALVHKFVRDHYSTRFPELERLVT
TPLEYAKVVSIIGNGPMTSDSITKLQTSTDNPLGLGLKAVLDGPSLMIVTVEATTSKGHDMSPEELQRVRKACDM
VISLHKAKNMLVEYVQSRMTVFAPNLTALIGSLTAAQLLNAAGGLTGLSKTPACNIPSWGSKKRQAGLATNVGIR
QQGYLYHSDMIQHIPNDLKKQAMRIVAAKLVLAARVDRIHSSSDGRTGDELRSACLERLEKLTEPPPNKGRRALP
IPDDKPSRKRGGRRARKAKEALAMTDLRKAQNRMAFGKEEKEVGYGTGEATVGLGMIGQQNDGRIRALQVDGRTR
AKLSAKNKGWGGATNAGAASTMSHHQPGGIDLRAKGLRTTGVGSTMGTTSSLTFTPVQGLELVDPKVQAELGRKR
KADEDRWFKGGSFTQIDDGGFKVPDLPAAKRLDTGSTKRK*
Coding >Ophun1|7159
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAGTCGGAGCCGCTTCAAGAC
CTCGCCGACCCGGAAAAGGAAGATGAAGGCGCCGAAGATGCCATGGACGTCGACGATGACGATGACGCACACGCA
GCCAAGGATATGCACGAGCTGGAAGACGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTGATGCAAACGCTGGAGCCCGTTCTCGAGGCTTCGGTGCAGACCGTGACT
GTGGGCAACATCGAGGATCACCCCGAGTACAGCCTCTTGACGCAATCCAACAGCCTATCAACCATGATCGATGGT
GAGGTGGCTCTCGTCCACAAGTTCGTCCGCGATCACTACTCGACTCGCTTCCCCGAACTCGAGAGGCTGGTGACG
ACGCCCCTGGAATACGCAAAGGTCGTATCCATCATCGGCAACGGGCCCATGACGTCGGACAGCATCACGAAGCTG
CAGACTTCGACGGATAACCCGCTCGGCTTGGGACTCAAGGCCGTCCTCGACGGACCGTCGCTCATGATTGTCACG
GTCGAGGCCACGACGTCAAAGGGCCACGACATGAGCCCAGAGGAGCTCCAGCGCGTACGAAAGGCCTGTGACATG
GTCATTTCCCTTCACAAGGCCAAGAACATGCTGGTGGAATACGTGCAATCGCGCATGACGGTCTTTGCGCCCAAC
CTGACGGCCCTCATCGGGTCCCTGACGGCGGCCCAGCTGCTCAACGCCGCCGGTGGTCTGACGGGCCTCTCCAAG
ACGCCGGCCTGCAACATACCATCGTGGGGATCCAAGAAGCGGCAGGCCGGGCTGGCGACCAACGTGGGCATCCGA
CAGCAGGGCTACCTCTATCACTCGGACATGATCCAACACATCCCCAACGACCTCAAGAAGCAGGCCATGCGCATC
GTGGCAGCCAAACTGGTCCTAGCCGCCCGCGTCGACCGCATCCACTCGAGCAGCGACGGCCGCACGGGAGACGAG
CTGCGCTCAGCCTGCCTGGAACGACTAGAGAAGCTCACGGAGCCTCCGCCCAACAAGGGCCGACGCGCGCTGCCC
ATCCCAGACGACAAGCCATCCCGCAAGCGCGGAGGACGACGAGCGCGCAAGGCCAAGGAGGCGCTGGCCATGACG
GACCTCCGCAAAGCCCAGAACCGCATGGCCTTTGGCAAGGAGGAGAAGGAGGTGGGCTACGGCACGGGAGAGGCC
ACCGTCGGCCTCGGCATGATCGGCCAGCAAAACGACGGCCGCATCCGAGCCCTCCAGGTCGACGGCCGAACTCGC
GCCAAGCTGAGCGCAAAGAACAAGGGATGGGGCGGCGCAACCAACGCGGGAGCGGCCTCGACCATGAGCCATCAT
CAGCCGGGCGGCATCGACCTCCGAGCCAAGGGCCTGCGAACGACGGGCGTGGGCAGCACCATGGGCACCACGTCG
TCTCTGACCTTCACCCCCGTCCAGGGCCTCGAGCTCGTCGATCCCAAAGTGCAGGCCGAGCTGGGCCGCAAGCGA
AAGGCTGATGAGGACCGGTGGTTCAAGGGCGGTTCCTTCACCCAGATTGACGACGGTGGCTTCAAGGTGCCGGAC
TTGCCGGCTGCGAAGCGGCTCGATACGGGGTCGACGAAGCGCAAGTGA
Transcript >Ophun1|7159
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAGTCGGAGCCGCTTCAAGAC
CTCGCCGACCCGGAAAAGGAAGATGAAGGCGCCGAAGATGCCATGGACGTCGACGATGACGATGACGCACACGCA
GCCAAGGATATGCACGAGCTGGAAGACGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTGATGCAAACGCTGGAGCCCGTTCTCGAGGCTTCGGTGCAGACCGTGACT
GTGGGCAACATCGAGGATCACCCCGAGTACAGCCTCTTGACGCAATCCAACAGCCTATCAACCATGATCGATGGT
GAGGTGGCTCTCGTCCACAAGTTCGTCCGCGATCACTACTCGACTCGCTTCCCCGAACTCGAGAGGCTGGTGACG
ACGCCCCTGGAATACGCAAAGGTCGTATCCATCATCGGCAACGGGCCCATGACGTCGGACAGCATCACGAAGCTG
CAGACTTCGACGGATAACCCGCTCGGCTTGGGACTCAAGGCCGTCCTCGACGGACCGTCGCTCATGATTGTCACG
GTCGAGGCCACGACGTCAAAGGGCCACGACATGAGCCCAGAGGAGCTCCAGCGCGTACGAAAGGCCTGTGACATG
GTCATTTCCCTTCACAAGGCCAAGAACATGCTGGTGGAATACGTGCAATCGCGCATGACGGTCTTTGCGCCCAAC
CTGACGGCCCTCATCGGGTCCCTGACGGCGGCCCAGCTGCTCAACGCCGCCGGTGGTCTGACGGGCCTCTCCAAG
ACGCCGGCCTGCAACATACCATCGTGGGGATCCAAGAAGCGGCAGGCCGGGCTGGCGACCAACGTGGGCATCCGA
CAGCAGGGCTACCTCTATCACTCGGACATGATCCAACACATCCCCAACGACCTCAAGAAGCAGGCCATGCGCATC
GTGGCAGCCAAACTGGTCCTAGCCGCCCGCGTCGACCGCATCCACTCGAGCAGCGACGGCCGCACGGGAGACGAG
CTGCGCTCAGCCTGCCTGGAACGACTAGAGAAGCTCACGGAGCCTCCGCCCAACAAGGGCCGACGCGCGCTGCCC
ATCCCAGACGACAAGCCATCCCGCAAGCGCGGAGGACGACGAGCGCGCAAGGCCAAGGAGGCGCTGGCCATGACG
GACCTCCGCAAAGCCCAGAACCGCATGGCCTTTGGCAAGGAGGAGAAGGAGGTGGGCTACGGCACGGGAGAGGCC
ACCGTCGGCCTCGGCATGATCGGCCAGCAAAACGACGGCCGCATCCGAGCCCTCCAGGTCGACGGCCGAACTCGC
GCCAAGCTGAGCGCAAAGAACAAGGGATGGGGCGGCGCAACCAACGCGGGAGCGGCCTCGACCATGAGCCATCAT
CAGCCGGGCGGCATCGACCTCCGAGCCAAGGGCCTGCGAACGACGGGCGTGGGCAGCACCATGGGCACCACGTCG
TCTCTGACCTTCACCCCCGTCCAGGGCCTCGAGCTCGTCGATCCCAAAGTGCAGGCCGAGCTGGGCCGCAAGCGA
AAGGCTGATGAGGACCGGTGGTTCAAGGGCGGTTCCTTCACCCAGATTGACGACGGTGGCTTCAAGGTGCCGGAC
TTGCCGGCTGCGAAGCGGCTCGATACGGGGTCGACGAAGCGCAAGTGA
Gene >Ophun1|7159
ATGTCGACCATCGTCGACGAACTCCTCAACGACTTTGGGGACTCGGGCGATGAACAGTCGGAGCCGCTTCAAGAC
CTCGCCGACCCGGAAAAGGAAGATGAAGGCGCCGAAGATGCCATGGACGTCGACGATGACGATGACGCACACGCA
GCCAAGGATATGCACGAGCTGGAAGACGCAGAGGCCACAAAGGCCAGGGTCGAGAAGATGAAGCTGGGCGCCGTC
AAGGATGTCCGCAGCGTCGCCAGCCTGATGCAAACGCTGGAGCCCGTTCTCGAGGTCAGTCCCTCTCCTGGTCCT
TGATTCAAAACTTTTTGTCCCGACCCTAGAAGACCTAACTAACTTGATCGTCTCGGCTCGACTACTAGAGAATCG
CCCAATTCCGTTCGCAGGCTTCGGTGCAGACCGTGACTGTGGGCAACATCGAGGATCACCCCGAGTACAGCCTCT
TGACGCAATCCAACAGCCTATCAACCATGATCGATGGTGAGGTGGCTCTCGTCCACAAGTTCGTCCGCGATCACT
ACTCGACTCGCTTCCCCGAACTCGAGAGGCTGGTGACGACGCCCCTGGAATACGCAAAGGTCGTATCCATCATCG
GCAACGGGCCCATGACGTCGGACAGCATCACGAAGCTGCAGACTTCGACGGATAACCCGCTCGGCTTGGGACTCA
AGGCCGTCCTCGACGGACCGTCGCTCATGATTGTCACGGTCGAGGCCACGACGTCAAAGGGCCACGACATGAGCC
CAGAGGAGCTCCAGCGCGTACGAAAGGCCTGTGACATGGTCATTTCCCTTCACAAGGCCAAGAACATGCTGGTGG
AATACGTGCAATCGCGCATGACGGTCTTTGCGCCCAACCTGACGGCCCTCATCGGGTCCCTGACGGCGGCCCAGC
TGCTCAACGCCGCCGGTGGTCTGACGGGCCTCTCCAAGACGCCGGCCTGCAACATACCATCGTGGGGATCCAAGA
AGCGGCAGGCCGGGCTGGCGACCAACGTGGGCATCCGACAGCAGGGCTACCTCTATCACTCGGACATGATCCAAC
ACATCCCCAACGACCTCAAGAAGCAGGCCATGCGCATCGTGGCAGCCAAACTGGTCCTAGCCGCCCGCGTCGACC
GCATCCACTCGAGCAGCGACGGCCGCACGGGAGACGAGCTGCGCTCAGCCTGCCTGGAACGACTAGAGAAGCTCA
CGGAGCCTCCGCCCAACAAGGGCCGACGCGCGCTGCCCATCCCAGACGACAAGCCATCCCGCAAGCGCGGAGGAC
GACGAGCGCGCAAGGCCAAGGAGGCGCTGGCCATGACGGACCTCCGCAAAGCCCAGAACCGCATGGCCTTTGGCA
AGGAGGAGAAGGAGGTGGGCTACGGCACGGGAGAGGCCACCGTCGGCCTCGGCATGATCGGCCAGCAAAACGACG
GCCGCATCCGAGCCCTCCAGGTCGACGGCCGAACTCGCGCCAAGCTGAGCGCAAAGAACAAGGGATGGGGCGGCG
CAACCAACGCGGGAGCGGCCTCGACCATGAGCCATCATCAGCCGGGCGGCATCGACCTCCGAGCCAAGGGCCTGC
GAACGACGGGCGTGGGCAGCACCATGGGCACCACGTCGTCTCTGACCTTCACCCCCGTCCAGGGCCTCGAGCTCG
TCGATCCCAAAGTGCAGGCCGAGCTGGGCCGCAAGCGAAAGGCTGATGAGGACCGGTGGTTCAAGGGCGGTTCCT
TCACCCAGATTGACGACGGTGGCTTCAAGGTGCCGGACTTGCCGGCTGCGAAGCGGCTCGATACGGGGTCGACGA
AGCGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail