Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7143
Gene name
LocationContig_86:22587..23810
Strand+
Gene length (bp)1223
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999757

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup98
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3581
Ophiocordyceps australis map64 (Brazil) OphauB2|324
Ophiocordyceps camponoti-floridani Ophcf2|01007
Ophiocordyceps camponoti-rufipedis Ophun1|7143 (this protein)
Ophiocordyceps kimflemingae Ophio5|7930
Ophiocordyceps subramaniannii Hirsu2|156
Ophiocordyceps subramaniannii Hirsu2|2137
Ophiocordyceps subramaniannii Hirsu2|3139
Ophiocordyceps subramaniannii Hirsu2|3419
Ophiocordyceps subramaniannii Hirsu2|5164
Ophiocordyceps subramaniannii Hirsu2|7455
Ophiocordyceps subramaniannii Hirsu2|9490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7143
MARLLSLLLLASPLLAFSNKVQTSYCNDFGAHCNIAPGDRIIEGYRLYPENASFDPKTCLVYFSSLWNNSIAIYD
AVHNKVIGSIDYPFGGRHDLHANAVLVDSCNRELTAGFTSAYTWDTSGARVDGPNFIAQYDLDTHELLWTVDLSP
PTGYRYGGFQDVAQDRYGNLFVAGTYPAALVRIEAKTQVVQPWYLSSASSTTTGYTGLAMFEFQKLLVSDQSAET
GSNLVSFDINKPLGPRPVPVTWASNGTLTGISVEPDAIVLAPKYRGKVLLVADNSLGTVVLYSDDRWVTAKKLGV
IPSLFSGTTPNPADAEAQVVVALQIGQRIFAVYEFFPDGVTLFPGAHRTAGERECFPLQDITDDVERLVQQYVNR
GRTIDWERPAYHY*
Coding >Ophun1|7143
ATGGCCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCCCCGTTGCTGGCCTTCTCGAACAAAGTGCAGACATCCTAT
TGCAATGATTTTGGAGCCCACTGCAACATTGCCCCGGGCGACAGAATCATCGAGGGCTACAGGCTCTACCCTGAG
AATGCCAGTTTCGACCCCAAGACATGTCTGGTGTATTTCAGCTCTCTATGGAATAACTCGATCGCCATCTATGAC
GCTGTACACAATAAAGTCATCGGGTCAATCGACTACCCCTTCGGAGGACGGCACGATCTGCACGCCAATGCCGTC
CTGGTCGACTCGTGCAATAGAGAATTGACAGCCGGCTTCACGTCCGCATACACGTGGGATACCTCAGGAGCCAGG
GTCGATGGGCCAAACTTCATCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCCCG
CCGACTGGCTACCGGTACGGAGGCTTCCAGGACGTGGCGCAGGACAGATACGGCAACCTCTTCGTCGCTGGGACT
TACCCGGCCGCCCTGGTGCGCATAGAAGCCAAGACCCAGGTGGTTCAGCCTTGGTATTTGTCGTCGGCCAGCTCG
ACCACCACGGGATACACAGGTCTGGCAATGTTCGAGTTCCAGAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACA
GGAAGCAACCTTGTCTCCTTTGATATCAACAAGCCATTGGGGCCGAGGCCGGTACCGGTGACTTGGGCTTCGAAC
GGGACTCTGACGGGCATATCGGTTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTACCGGGGCAAGGTTCTTCTG
GTTGCAGACAACTCCCTCGGCACCGTCGTTCTGTACTCGGACGATCGCTGGGTAACGGCTAAGAAGCTCGGCGTC
ATTCCGAGTCTGTTCTCAGGCACTACTCCGAACCCTGCTGATGCGGAGGCGCAAGTGGTCGTTGCGCTTCAAATC
GGACAACGCATTTTCGCAGTGTACGAGTTCTTCCCCGATGGTGTTACCCTGTTCCCTGGAGCTCATCGGACGGCC
GGTGAGAGGGAATGCTTCCCGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAGCAGTATGTCAACAGG
GGCAGGACGATTGACTGGGAGAGACCGGCGTATCATTACTGA
Transcript >Ophun1|7143
ATGGCCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCCCCGTTGCTGGCCTTCTCGAACAAAGTGCAGACATCCTAT
TGCAATGATTTTGGAGCCCACTGCAACATTGCCCCGGGCGACAGAATCATCGAGGGCTACAGGCTCTACCCTGAG
AATGCCAGTTTCGACCCCAAGACATGTCTGGTGTATTTCAGCTCTCTATGGAATAACTCGATCGCCATCTATGAC
GCTGTACACAATAAAGTCATCGGGTCAATCGACTACCCCTTCGGAGGACGGCACGATCTGCACGCCAATGCCGTC
CTGGTCGACTCGTGCAATAGAGAATTGACAGCCGGCTTCACGTCCGCATACACGTGGGATACCTCAGGAGCCAGG
GTCGATGGGCCAAACTTCATCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCCCG
CCGACTGGCTACCGGTACGGAGGCTTCCAGGACGTGGCGCAGGACAGATACGGCAACCTCTTCGTCGCTGGGACT
TACCCGGCCGCCCTGGTGCGCATAGAAGCCAAGACCCAGGTGGTTCAGCCTTGGTATTTGTCGTCGGCCAGCTCG
ACCACCACGGGATACACAGGTCTGGCAATGTTCGAGTTCCAGAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACA
GGAAGCAACCTTGTCTCCTTTGATATCAACAAGCCATTGGGGCCGAGGCCGGTACCGGTGACTTGGGCTTCGAAC
GGGACTCTGACGGGCATATCGGTTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTACCGGGGCAAGGTTCTTCTG
GTTGCAGACAACTCCCTCGGCACCGTCGTTCTGTACTCGGACGATCGCTGGGTAACGGCTAAGAAGCTCGGCGTC
ATTCCGAGTCTGTTCTCAGGCACTACTCCGAACCCTGCTGATGCGGAGGCGCAAGTGGTCGTTGCGCTTCAAATC
GGACAACGCATTTTCGCAGTGTACGAGTTCTTCCCCGATGGTGTTACCCTGTTCCCTGGAGCTCATCGGACGGCC
GGTGAGAGGGAATGCTTCCCGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAGCAGTATGTCAACAGG
GGCAGGACGATTGACTGGGAGAGACCGGCGTATCATTACTGA
Gene >Ophun1|7143
ATGGCCCGTCTGCTGTCCCTCCTCCTGCTGGCCTCCCCGTTGCTGGCCTTCTCGAACAAAGTGCAGACATCCTAT
TGCAATGATTTTGGAGCCCACTGCAACATTGCCCCGGGCGACAGAATCATCGAGGGCTACAGGCTCTACCCTGAG
AATGCCAGTTTCGACCCCAAGACATGTCTGGTGTATTTCAGGTGAGATGACGGCATCAATGGTGCTTACATTGTG
CATGTGAGGCTGATGGTAGTAGCTCTCTATGGAATAACTCGATCGCCATCTATGACGCTGTACACAATAAAGTCA
TCGGGTCAATCGACTACCCCTTCGGAGGACGGCACGATCTGCACGCCAATGCCGTCCTGGTCGACTCGTGCAATA
GAGAATTGACAGCCGGCTTCACGTCCGCATACACGTGGGATACCTCAGGAGCCAGGGTCGATGGGCCAAACTTCA
TCGCCCAATATGATCTCGATACTCACGAGTTGCTCTGGACCGTCGATCTCTCCCCGCCGACTGGCTACCGGTACG
GAGGCTTCCAGGACGTGGCGCAGGACAGATACGGCAACCTCTTCGTCGCTGGGACTTACCCGGCCGCCCTGGTGC
GCATAGAAGCCAAGACCCAGGTGGTTCAGCCTTGGTATTTGTCGTCGGCCAGCTCGACCACCACGGGATACACAG
GTCTGGCAATGTTCGAGTTCCAGAAGCTCCTGGTCTCGGACCAGTCAGCCGAGACAGGAAGCAACCTTGTCTCCT
TTGATATCAACAAGCCATTGGGGCCGAGGCCGGTACCGGTGACTTGGGCTTCGAACGGGACTCTGACGGGCATAT
CGGTTGAGCCCGATGCCATCGTGCTGGCCCCCAAGTACCGGGGCAAGGTTCTTCTGGTTGCAGACAACTCCCTCG
GCACCGTCGTTCTGTACTCGGACGATCGCTGGGTAACGGCTAAGAAGCTCGGCGTCATTCCGAGTCTGTTCTCAG
GCACTACTCCGAACCCTGCTGATGCGGAGGCGCAAGTGGTCGTTGCGCTTCAAATCGGACAACGCATTTTCGCAG
TGTACGAGTTCTTCCCCGATGGTGTTACCCTGTTCCCTGGAGCTCATCGGACGGCCGGTGAGAGGGAATGCTTCC
CGTTGCAAGATATCACGGACGACGTGGAGAGGCTAGTGCAGCAGTATGTCAACAGGGGCAGGACGATTGACTGGG
AGAGACCGGCGTATCATTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail