Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7136
Gene name
LocationContig_86:9462..10788
Strand+
Gene length (bp)1326
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12710 HAD haloacid dehalogenase-like hydrolase 2.0E-25 223 395
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.4E-19 221 398
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 3.6E-08 363 414

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O28142|SERB_ARCFU Phosphoserine phosphatase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2138 PE=3 SV=1 216 425 2.0E-51
sp|P42941|SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER2 PE=1 SV=1 206 436 1.0E-50
sp|O74382|SERB_SCHPO Probable phosphoserine phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.07c PE=2 SV=1 194 441 3.0E-50
sp|A0QJI1|SERB_MYCA1 Phosphoserine phosphatase OS=Mycobacterium avium (strain 104) GN=serB PE=1 SV=1 196 437 6.0E-50
sp|P0AGB2|SERB_SHIFL Phosphoserine phosphatase OS=Shigella flexneri GN=serB PE=3 SV=1 218 429 7.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O28142|SERB_ARCFU Phosphoserine phosphatase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2138 PE=3 SV=1 216 425 2.0E-51
sp|P42941|SERB_YEAST Phosphoserine phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SER2 PE=1 SV=1 206 436 1.0E-50
sp|O74382|SERB_SCHPO Probable phosphoserine phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.07c PE=2 SV=1 194 441 3.0E-50
sp|A0QJI1|SERB_MYCA1 Phosphoserine phosphatase OS=Mycobacterium avium (strain 104) GN=serB PE=1 SV=1 196 437 6.0E-50
sp|P0AGB2|SERB_SHIFL Phosphoserine phosphatase OS=Shigella flexneri GN=serB PE=3 SV=1 218 429 7.0E-44
sp|P0AGB0|SERB_ECOLI Phosphoserine phosphatase OS=Escherichia coli (strain K12) GN=serB PE=1 SV=1 218 429 7.0E-44
sp|P0AGB1|SERB_ECO57 Phosphoserine phosphatase OS=Escherichia coli O157:H7 GN=serB PE=3 SV=1 218 429 7.0E-44
sp|Q58989|SERB_METJA Phosphoserine phosphatase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1594 PE=1 SV=1 216 426 6.0E-38
sp|P44997|SERB_HAEIN Phosphoserine phosphatase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=serB PE=3 SV=1 222 429 9.0E-38
sp|B0R7U7|SERB_HALS3 Phosphoserine phosphatase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=serB PE=3 SV=2 222 414 8.0E-19
sp|Q5M819|SERB_RAT Phosphoserine phosphatase OS=Rattus norvegicus GN=Psph PE=2 SV=1 223 391 7.0E-12
sp|Q5RB83|SERB_PONAB Phosphoserine phosphatase OS=Pongo abelii GN=PSPH PE=2 SV=1 223 391 1.0E-11
sp|P78330|SERB_HUMAN Phosphoserine phosphatase OS=Homo sapiens GN=PSPH PE=1 SV=2 223 391 1.0E-11
sp|Q99LS3|SERB_MOUSE Phosphoserine phosphatase OS=Mus musculus GN=Psph PE=1 SV=1 223 391 2.0E-11
sp|Q2KHU0|SERB_BOVIN Phosphoserine phosphatase OS=Bos taurus GN=PSPH PE=2 SV=1 223 391 5.0E-11
sp|O82796|SERC_ARATH Phosphoserine phosphatase, chloroplastic OS=Arabidopsis thaliana GN=PSP PE=1 SV=2 215 391 8.0E-09
sp|Q9VSY6|SERB_DROME Phosphoserine phosphatase OS=Drosophila melanogaster GN=aay PE=2 SV=1 218 391 9.0E-09
sp|P9WGJ1|Y3661_MYCTU Uncharacterized protein Rv3661 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3661 PE=1 SV=1 300 416 1.0E-08
sp|P9WGJ0|Y3661_MYCTO Uncharacterized protein MT3761 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3761 PE=3 SV=1 300 416 1.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2106
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2101
Ophiocordyceps australis map64 (Brazil) OphauB2|1489
Ophiocordyceps camponoti-floridani Ophcf2|01003
Ophiocordyceps camponoti-rufipedis Ophun1|7136 (this protein)
Ophiocordyceps kimflemingae Ophio5|7918
Ophiocordyceps subramaniannii Hirsu2|2488

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7136
MAEARQRPQLAATTRSSSYLSDLQQYRPPKPAHPGIDAVVADKSSSSPPPFNGIPSDENPPIIVESGLSHALSHA
SCAPAPGRRSDRLVATIFYKRSAVEDVAPAHSLDDFPLEPPAASEAEQLDHLYGSYVSPLCVASFLHLMSTFPQP
HDDADEPHSSHRCLDSQHQPRVVELTLGPAPSPRYLSLDDLRRHEAIYRFEREWSVYVALQRDIVWRRHPRLVVF
DMDSTLITQEVIELLAATVKNPPDMVARVASITERAMRGELEFDASFRERLALLKGLDASLFDDLRPVLQLSPGA
ADLVRALKRLGVKTAILSGGFQPLTEWLARQLGIDYAYANHIVVENGKITGQVQGTIVGKERKRDLLVEIAAKEK
IDLAQVVAVGDGANDLLMLEAAGLGVAWNAKPRVQLEADARLNGESLLDLLFLFGFTAEEIQMLIE*
Coding >Ophun1|7136
ATGGCCGAAGCCCGGCAACGTCCGCAGCTCGCGGCCACCACCCGCAGCAGCTCCTATCTCTCCGACCTCCAGCAG
TATCGCCCCCCGAAGCCCGCTCACCCGGGCATCGACGCCGTCGTCGCCGATAAATCTTCTTCCTCTCCGCCCCCC
TTCAACGGCATCCCCTCGGATGAGAACCCGCCCATCATCGTCGAGAGCGGCCTGAGCCATGCCCTCTCTCACGCC
AGTTGCGCTCCCGCTCCCGGCCGTCGCTCCGATCGTCTCGTCGCAACCATCTTCTATAAGCGCTCTGCTGTCGAG
GACGTCGCTCCAGCCCACTCGCTCGATGACTTCCCGCTCGAACCTCCAGCCGCGTCCGAAGCCGAGCAGCTCGAC
CACCTCTACGGCTCTTACGTCTCTCCCCTATGTGTTGCCTCCTTCTTACACCTCATGTCGACCTTCCCCCAACCC
CACGACGATGCCGACGAACCGCACTCGTCCCACCGCTGCCTCGACAGCCAGCACCAGCCGCGCGTCGTCGAGCTG
ACGCTGGGTCCCGCCCCTTCGCCTCGCTACCTAAGCCTCGATGACCTCCGCCGTCACGAGGCCATCTACCGTTTC
GAACGCGAGTGGAGCGTCTACGTCGCTCTACAGCGGGACATTGTCTGGCGCCGCCATCCGCGCCTCGTCGTCTTC
GACATGGACAGCACACTAATCACCCAGGAAGTCATCGAACTACTCGCCGCCACCGTCAAGAACCCTCCCGACATG
GTCGCCCGCGTCGCCTCCATCACCGAGCGCGCCATGCGCGGCGAACTCGAATTCGACGCCTCCTTCCGCGAACGC
CTCGCTCTCCTCAAAGGCCTCGATGCTTCCCTATTCGACGACCTACGTCCCGTCCTCCAACTCTCCCCCGGCGCC
GCCGACCTCGTCCGCGCCCTGAAGCGCCTGGGCGTCAAGACGGCCATCCTCTCCGGCGGCTTCCAGCCCCTGACG
GAATGGCTCGCGCGCCAGCTAGGCATCGACTACGCCTACGCCAACCACATCGTCGTCGAAAACGGCAAAATCACC
GGCCAAGTCCAAGGCACCATCGTCGGCAAGGAGCGCAAACGCGACCTCCTCGTCGAAATCGCCGCCAAGGAGAAG
ATCGACCTGGCCCAGGTGGTGGCCGTCGGCGACGGCGCAAACGACTTGCTCATGCTGGAGGCCGCCGGACTGGGC
GTCGCCTGGAACGCCAAGCCGCGCGTCCAGCTCGAGGCCGACGCCCGTCTCAACGGGGAGAGCTTATTGGATCTT
CTCTTCCTGTTTGGCTTTACGGCCGAGGAGATTCAGATGCTGATTGAGTAG
Transcript >Ophun1|7136
ATGGCCGAAGCCCGGCAACGTCCGCAGCTCGCGGCCACCACCCGCAGCAGCTCCTATCTCTCCGACCTCCAGCAG
TATCGCCCCCCGAAGCCCGCTCACCCGGGCATCGACGCCGTCGTCGCCGATAAATCTTCTTCCTCTCCGCCCCCC
TTCAACGGCATCCCCTCGGATGAGAACCCGCCCATCATCGTCGAGAGCGGCCTGAGCCATGCCCTCTCTCACGCC
AGTTGCGCTCCCGCTCCCGGCCGTCGCTCCGATCGTCTCGTCGCAACCATCTTCTATAAGCGCTCTGCTGTCGAG
GACGTCGCTCCAGCCCACTCGCTCGATGACTTCCCGCTCGAACCTCCAGCCGCGTCCGAAGCCGAGCAGCTCGAC
CACCTCTACGGCTCTTACGTCTCTCCCCTATGTGTTGCCTCCTTCTTACACCTCATGTCGACCTTCCCCCAACCC
CACGACGATGCCGACGAACCGCACTCGTCCCACCGCTGCCTCGACAGCCAGCACCAGCCGCGCGTCGTCGAGCTG
ACGCTGGGTCCCGCCCCTTCGCCTCGCTACCTAAGCCTCGATGACCTCCGCCGTCACGAGGCCATCTACCGTTTC
GAACGCGAGTGGAGCGTCTACGTCGCTCTACAGCGGGACATTGTCTGGCGCCGCCATCCGCGCCTCGTCGTCTTC
GACATGGACAGCACACTAATCACCCAGGAAGTCATCGAACTACTCGCCGCCACCGTCAAGAACCCTCCCGACATG
GTCGCCCGCGTCGCCTCCATCACCGAGCGCGCCATGCGCGGCGAACTCGAATTCGACGCCTCCTTCCGCGAACGC
CTCGCTCTCCTCAAAGGCCTCGATGCTTCCCTATTCGACGACCTACGTCCCGTCCTCCAACTCTCCCCCGGCGCC
GCCGACCTCGTCCGCGCCCTGAAGCGCCTGGGCGTCAAGACGGCCATCCTCTCCGGCGGCTTCCAGCCCCTGACG
GAATGGCTCGCGCGCCAGCTAGGCATCGACTACGCCTACGCCAACCACATCGTCGTCGAAAACGGCAAAATCACC
GGCCAAGTCCAAGGCACCATCGTCGGCAAGGAGCGCAAACGCGACCTCCTCGTCGAAATCGCCGCCAAGGAGAAG
ATCGACCTGGCCCAGGTGGTGGCCGTCGGCGACGGCGCAAACGACTTGCTCATGCTGGAGGCCGCCGGACTGGGC
GTCGCCTGGAACGCCAAGCCGCGCGTCCAGCTCGAGGCCGACGCCCGTCTCAACGGGGAGAGCTTATTGGATCTT
CTCTTCCTGTTTGGCTTTACGGCCGAGGAGATTCAGATGCTGATTGAGTAG
Gene >Ophun1|7136
ATGGCCGAAGCCCGGCAACGTCCGCAGCTCGCGGCCACCACCCGCAGCAGCTCCTATCTCTCCGACCTCCAGCAG
TATCGCCCCCCGAAGCCCGCTCACCCGGGCATCGACGCCGTCGTCGCCGATAAATCTTCTTCCTCTCCGCCCCCC
TTCAACGGCATCCCCTCGGATGAGAACCCGCCCATCATCGTCGAGAGCGGCCTGAGCCATGCCCTCTCTCACGCC
AGTTGCGCTCCCGCTCCCGGCCGTCGCTCCGATCGTCTCGTCGCAACCATCTTCTATAAGCGCTCTGCTGTCGAG
GACGTCGCTCCAGCCCACTCGCTCGATGACTTCCCGCTCGAACCTCCAGCCGCGTCCGAAGCCGAGCAGCTCGAC
CACCTCTACGGCTCTTACGTCTCTCCCCTATGTGTTGCCTCCTTCTTACACCTCATGTCGACCTTCCCCCAACCC
CACGACGATGCCGACGAACCGCACTCGTCCCACCGCTGCCTCGACAGCCAGCACCAGCCGCGCGTCGTCGAGCTG
ACGCTGGGTCCCGCCCCTTCGCCTCGCTACCTAAGCCTCGATGACCTCCGCCGTCACGAGGCCATCTACCGTTTC
GAACGCGAGTGGAGCGTCTACGTCGCTCTACAGCGGGACATTGTCTGGCGCCGCCATCCGCGCCTCGTCGTCTTC
GACATGGACAGCACACTAATCACCCAGGAAGTCATCGAACTACTCGCCGCCACCGTCAAGAACCCTCCCGACATG
GTCGCCCGCGTCGCCTCCATCACCGAGCGCGCCATGCGCGGCGAACTCGAATTCGACGCCTCCTTCCGCGAACGC
CTCGCTCTCCTCAAAGGCCTCGATGCTTCCCTATTCGACGACCTACGTCCCGTCCTCCAACTCTCCCCCGGCGCC
GCCGACCTCGTCCGCGCCCTGAAGCGCCTGGGCGTCAAGACGGCCATCCTCTCCGGCGGCTTCCAGCCCCTGACG
GAATGGCTCGCGCGCCAGCTAGGCATCGACTACGCCTACGCCAACCACATCGTCGTCGAAAACGGCAAAATCACC
GGCCAAGTCCAAGGCACCATCGTCGGCAAGGAGCGCAAACGCGACCTCCTCGTCGAAATCGCCGCCAAGGAGAAG
ATCGACCTGGCCCAGGTGGTGGCCGTCGGCGACGGCGCAAACGACTTGCTCATGCTGGAGGCCGCCGGACTGGGC
GTCGCCTGGAACGCCAAGCCGCGCGTCCAGCTCGAGGCCGACGCCCGTCTCAACGGGGAGAGCTTATTGGATCTT
CTCTTCCTGTTTGGCTTTACGGCCGAGGAGATTCAGATGCTGATTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail