Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|713
Gene name
LocationContig_123:18582..19073
Strand-
Gene length (bp)491
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02271 UCR_14kD Ubiquinol-cytochrome C reductase complex 14kD subunit 1.9E-44 14 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q871K1|QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-7 PE=3 SV=1 1 123 9.0E-53
sp|O74533|QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr7 PE=3 SV=1 1 122 3.0E-39
sp|P49345|QCR7_KLULA Cytochrome b-c1 complex subunit 7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR7 PE=3 SV=1 2 122 1.0E-37
sp|Q6C3K7|QCR7_YARLI Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1 2 123 6.0E-35
sp|P00128|QCR7_YEAST Cytochrome b-c1 complex subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR7 PE=1 SV=2 2 122 1.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q871K1|QCR7_NEUCR Cytochrome b-c1 complex subunit 7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qcr-7 PE=3 SV=1 1 123 9.0E-53
sp|O74533|QCR7_SCHPO Cytochrome b-c1 complex subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=qcr7 PE=3 SV=1 1 122 3.0E-39
sp|P49345|QCR7_KLULA Cytochrome b-c1 complex subunit 7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR7 PE=3 SV=1 2 122 1.0E-37
sp|Q6C3K7|QCR7_YARLI Cytochrome b-c1 complex subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=QCR7 PE=3 SV=1 2 123 6.0E-35
sp|P00128|QCR7_YEAST Cytochrome b-c1 complex subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR7 PE=1 SV=2 2 122 1.0E-32
sp|Q751U4|QCR7_ASHGO Cytochrome b-c1 complex subunit 7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=QCR7 PE=3 SV=1 2 120 8.0E-32
sp|Q6BNQ5|QCR7_DEBHA Cytochrome b-c1 complex subunit 7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=QCR7 PE=3 SV=1 2 120 1.0E-26
sp|Q6FSJ2|QCR7_CANGA Cytochrome b-c1 complex subunit 7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=QCR7 PE=3 SV=1 2 123 3.0E-26
sp|P46268|QCR7_CYBJA Cytochrome b-c1 complex subunit 7 OS=Cyberlindnera jadinii GN=QCR7 PE=3 SV=1 2 122 1.0E-19
sp|Q5RC24|QCR7_PONAB Cytochrome b-c1 complex subunit 7 OS=Pongo abelii GN=UQCRB PE=3 SV=3 18 112 8.0E-18
sp|P00129|QCR7_BOVIN Cytochrome b-c1 complex subunit 7 OS=Bos taurus GN=UQCRB PE=1 SV=3 23 112 1.0E-17
sp|P14927|QCR7_HUMAN Cytochrome b-c1 complex subunit 7 OS=Homo sapiens GN=UQCRB PE=1 SV=2 18 112 2.0E-17
sp|Q9D855|QCR7_MOUSE Cytochrome b-c1 complex subunit 7 OS=Mus musculus GN=Uqcrb PE=1 SV=3 18 112 4.0E-17
sp|Q9GP40|QCR7_ECHMU Cytochrome b-c1 complex subunit 7 OS=Echinococcus multilocularis GN=UBCRBP PE=2 SV=1 10 118 4.0E-14
sp|O01369|QCR7_FASHE Cytochrome b-c1 complex subunit 7 OS=Fasciola hepatica GN=UBCRBP PE=3 SV=2 33 116 1.0E-10
sp|O01374|QCR7_SCHMA Cytochrome b-c1 complex subunit 7 OS=Schistosoma mansoni PE=3 SV=1 29 118 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0032991 protein-containing complex No
GO:0044237 cellular metabolic process No
GO:0019646 aerobic electron transport chain No
GO:1902494 catalytic complex No
GO:0009987 cellular process No
GO:1990351 transporter complex No
GO:0009060 aerobic respiration No
GO:0008152 metabolic process No
GO:0045275 respiratory chain complex III No
GO:0045333 cellular respiration No
GO:0098798 mitochondrial protein-containing complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0098796 membrane protein complex No
GO:0022904 respiratory electron transport chain No
GO:0070069 cytochrome complex No
GO:0005575 cellular_component No
GO:0098803 respiratory chain complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0008150 biological_process No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:1902495 transmembrane transporter complex No
GO:1990204 oxidoreductase complex No
GO:0022900 electron transport chain No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4043
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4984
Ophiocordyceps australis map64 (Brazil) OphauB2|629
Ophiocordyceps camponoti-floridani Ophcf2|06827
Ophiocordyceps camponoti-rufipedis Ophun1|713 (this protein)
Ophiocordyceps kimflemingae Ophio5|317
Ophiocordyceps subramaniannii Hirsu2|8139

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|713
MSAVSLGPFILQRPWLHKMIMPLANWYANAAGYRKLGLRYDDLLEEEREAVQIALKRLSPKEAYDRVYRLRRSTQ
LSYQHKLLPKEQWTKPEEDTPYLRPLVEQVEAELAEKNAFDSMEVFKKH*
Coding >Ophun1|713
ATGAGCGCAGTCTCCCTCGGACCCTTTATCCTGCAGCGCCCATGGCTGCACAAGATGATTATGCCTCTTGCCAAT
TGGTACGCCAACGCCGCCGGCTACCGCAAGCTGGGTCTGAGATACGATGATCTTCTCGAGGAGGAGCGCGAAGCT
GTTCAGATAGCCCTCAAGCGTCTGTCTCCCAAGGAGGCCTACGACCGCGTCTACCGTCTCCGCCGCTCTACCCAA
TTGAGCTACCAGCACAAGCTGCTCCCCAAGGAACAGTGGACAAAGCCCGAAGAGGACACGCCGTATCTCCGCCCA
CTCGTCGAGCAAGTCGAGGCCGAGCTCGCCGAAAAGAACGCCTTTGACTCCATGGAAGTTTTCAAGAAGCACTGA
Transcript >Ophun1|713
ATGAGCGCAGTCTCCCTCGGACCCTTTATCCTGCAGCGCCCATGGCTGCACAAGATGATTATGCCTCTTGCCAAT
TGGTACGCCAACGCCGCCGGCTACCGCAAGCTGGGTCTGAGATACGATGATCTTCTCGAGGAGGAGCGCGAAGCT
GTTCAGATAGCCCTCAAGCGTCTGTCTCCCAAGGAGGCCTACGACCGCGTCTACCGTCTCCGCCGCTCTACCCAA
TTGAGCTACCAGCACAAGCTGCTCCCCAAGGAACAGTGGACAAAGCCCGAAGAGGACACGCCGTATCTCCGCCCA
CTCGTCGAGCAAGTCGAGGCCGAGCTCGCCGAAAAGAACGCCTTTGACTCCATGGAAGTTTTCAAGAAGCACTGA
Gene >Ophun1|713
ATGAGCGCAGTCTCCCTCGGACCCTTTATCCTGCAGCGCCCATGGCTGCACAAGATGATTATGCCTCTTGCCAAT
TGGTACGCCAACGCCGCCGGCTACCGCAAGCTGGGTCTGAGGTAAAAACCGATCAACGAACCGAGCTCCCGGTGC
CTCGTCCTTCATGAAGCTGACGTCTTCGGATTCAGATACGATGATCTTCTCGAGGAGGAGCGCGAAGCTGTTCAG
ATAGCCCTCAAGCGTCTGTCTCCCAAGGAGGCCTACGACCGCGTCTACCGTCTCCGCCGCTCTACCCAATTGAGC
TACCAGCACAAGCTGCTCCCCAAGGAACAGTGGACAAAGCCCGAAGAGGTAGACATGCTCCTCGTCTCTCCGAAA
CTCTCGCTAAGGAAGCACAGGACACGCCGTATCTCCGCCCACTCGTCGAGCAAGTCGAGGCCGAGCTCGCCGAAA
AGAACGCCTTTGACTCCATGGAAGTTTTCAAGAAGCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail