Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7125
Gene name
LocationContig_858:50..3440
Strand+
Gene length (bp)3390
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08202 MIS13 Mis12-Mtw1 protein family 2.7E-53 376 668
PF00170 bZIP_1 bZIP transcription factor 1.1E-12 109 165
PF07716 bZIP_2 Basic region leucine zipper 2.9E-05 115 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 105 181 7.0E-27
sp|Q9UUB5|MIS13_SCHPO Kinetochore protein mis13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis13 PE=1 SV=1 374 538 2.0E-25
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 98 176 6.0E-18
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 98 176 6.0E-18
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 98 176 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52890|ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf1 PE=1 SV=1 105 181 7.0E-27
sp|Q9UUB5|MIS13_SCHPO Kinetochore protein mis13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis13 PE=1 SV=1 374 538 2.0E-25
sp|Q5R9C9|ATF7_PONAB Cyclic AMP-dependent transcription factor ATF-7 OS=Pongo abelii GN=ATF7 PE=2 SV=1 98 176 6.0E-18
sp|P17544|ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens GN=ATF7 PE=1 SV=2 98 176 6.0E-18
sp|Q8R0S1|ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus GN=Atf7 PE=2 SV=1 98 176 7.0E-18
sp|Q8K1L0|CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus GN=Creb5 PE=2 SV=3 98 176 9.0E-17
sp|O93602|ATF2_CHICK Cyclic AMP-dependent transcription factor ATF-2 OS=Gallus gallus GN=ATF2 PE=2 SV=1 98 176 1.0E-16
sp|Q02930|CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens GN=CREB5 PE=1 SV=3 98 176 4.0E-16
sp|P16951|ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus GN=Atf2 PE=1 SV=2 107 176 7.0E-16
sp|Q00969|ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus GN=Atf2 PE=1 SV=2 107 176 7.0E-16
sp|P15336|ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens GN=ATF2 PE=1 SV=4 107 176 1.0E-15
sp|P78962|ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf21 PE=3 SV=1 105 175 2.0E-13
sp|Q09771|ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atf31 PE=3 SV=1 116 177 2.0E-10
sp|Q59VR1|SKO1_CANAL Transcriptional regulator SKO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKO1 PE=1 SV=1 104 164 6.0E-08
sp|Q09926|PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcr1 PE=1 SV=1 100 176 4.0E-07
sp|P17535|JUND_HUMAN Transcription factor jun-D OS=Homo sapiens GN=JUND PE=1 SV=3 116 179 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051301 cell division Yes
GO:0007059 chromosome segregation Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0000444 MIS12/MIND type complex Yes
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0009987 cellular process No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4920
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3601
Ophiocordyceps australis map64 (Brazil) OphauB2|5276
Ophiocordyceps camponoti-rufipedis Ophun1|7125 (this protein)
Ophiocordyceps kimflemingae Ophio5|4598
Ophiocordyceps subramaniannii Hirsu2|1545

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7125
MAHHSHNHATSIDSGRAASENSNISEEGSKSKSSTRGRAKKNSVSSNGRRKADELPAKLPPSKKGKGNNGMMNGG
PGSSDEDEDDDDDDDLKTKMEDGGSKSKMTDEEKRKNFLERNRVAALKCRQRKKQWLANLQNKVELFSTENDALS
NQITQLKEEVVNLKALLLAHKDCSVTQQHGAYMSQMEPYNTQMNPYAAADLEEDEDFQFVRKSKRPKKEEQDAPK
PARKTGRKPKATRESDIVETVQPASESRRSSRRRASGDGEADAPPAVKRATRHSKRLSGDAPDELEGNGLVEGRR
RAKGSTRRGDDEVKNRRTSRSGNDRDQAETTSRRSPDEAKASRSSSNNNKTRKTKPAAAIRSSPQQPATSAMTIA
LPMSDTPVINRNKEMRRKGPSNRRSSLGSRGRRASSLIDSGQAALPHREVDSADFYKHITADGLPEPRRMKQLLM
WCGERALSDKPPHGTAASNAILGARAIQDQLLKDFASKSEFSDWFSRGEDGAKVQVILKPNPRNAELDEKMEALE
AKIARLREEKRAWLEIRKPPPDLPPLFPDDSTTTDAVILPDFNLLDDDEVAIGRFLADEEQSLAAARTRTEEQLR
GIQASLTLQVDELADSVHKLEQRVLVAGDEAALVLRLAAMRLREREDREKESAGTKGMPVTKVLRSLGRILPEGS
GG*
Coding >Ophun1|7125
ATGGCGCATCATTCCCACAACCACGCGACATCGATAGACTCGGGCCGAGCCGCGAGTGAGAATAGCAATATATCG
GAAGAGGGCTCGAAGTCCAAGTCGAGCACGAGAGGCCGAGCCAAGAAGAACAGCGTCAGCAGCAACGGCCGGAGG
AAAGCAGACGAGTTACCGGCAAAACTACCTCCGAGTAAGAAAGGAAAGGGCAACAATGGCATGATGAATGGTGGC
CCGGGTAGTTCTGACGAAGATGAAGATGATGACGACGATGACGATCTCAAGACCAAGATGGAGGATGGCGGCTCC
AAGTCCAAGATGACGGACGAGGAGAAGCGCAAAAACTTCCTCGAGAGGAATCGCGTCGCCGCCCTCAAATGCCGA
CAGCGCAAAAAGCAGTGGCTCGCAAACCTGCAGAACAAGGTCGAGCTTTTCAGCACGGAGAACGACGCCCTGTCG
AATCAGATCACGCAGTTGAAGGAAGAGGTGGTGAATCTCAAGGCGCTTCTGCTAGCTCACAAGGACTGTTCCGTC
ACTCAACAGCACGGCGCCTACATGTCGCAAATGGAGCCATACAACACGCAGATGAACCCGTACGCCGCTGCGGAT
CTGGAGGAGGACGAAGATTTTCAATTTGTTCGCAAGTCGAAACGGCCCAAGAAGGAAGAGCAGGATGCGCCAAAA
CCGGCCAGAAAGACTGGCCGGAAGCCCAAAGCTACGAGAGAGTCGGACATCGTCGAGACTGTACAGCCCGCGTCC
GAGTCGAGACGGTCTTCGAGGAGGAGGGCCAGTGGAGATGGCGAGGCTGATGCGCCACCGGCGGTGAAACGCGCG
ACGAGGCACAGCAAGCGACTTTCTGGCGATGCGCCTGACGAGCTCGAGGGCAATGGCCTGGTCGAAGGAAGGCGG
AGGGCCAAGGGTTCGACGCGACGCGGTGATGACGAGGTGAAGAATAGGCGTACGTCTCGCAGTGGAAACGACAGA
GACCAGGCAGAGACGACATCACGCAGAAGTCCGGACGAGGCGAAGGCGTCGCGCAGCAGCAGCAATAACAACAAG
ACGCGGAAGACGAAGCCGGCCGCGGCCATCCGATCTTCGCCTCAGCAGCCCGCGACATCAGCCATGACGATCGCG
CTACCGATGAGCGACACACCAGTCATCAATCGCAACAAGGAGATGCGCAGAAAGGGGCCGTCCAACCGGCGAAGC
AGCCTGGGCTCGCGCGGCCGGCGGGCTAGTTCACTCATCGATAGCGGCCAGGCTGCACTCCCGCACCGCGAGGTC
GACTCGGCCGACTTTTACAAGCACATCACGGCCGACGGGCTGCCGGAGCCGCGGCGTATGAAACAGCTGCTCATG
TGGTGCGGCGAGCGCGCGCTGTCGGACAAGCCGCCGCACGGCACAGCAGCTTCGAACGCGATCCTTGGCGCTCGC
GCGATCCAGGATCAGCTACTCAAGGACTTTGCTTCCAAGTCGGAGTTTTCCGATTGGTTCAGTAGGGGCGAGGAC
GGGGCCAAGGTTCAGGTCATTCTGAAGCCGAATCCGCGGAATGCGGAGCTTGACGAGAAGATGGAAGCGTTGGAG
GCGAAGATTGCCAGGCTGCGAGAAGAGAAGAGAGCATGGCTAGAGATTCGCAAGCCGCCGCCCGACCTGCCACCG
CTGTTCCCCGATGACTCGACGACGACGGACGCCGTGATACTACCAGACTTTAACCTCCTAGACGACGACGAGGTC
GCCATCGGACGCTTCCTCGCCGACGAGGAGCAATCCTTGGCTGCGGCGCGGACACGGACGGAGGAGCAGCTGCGG
GGGATTCAGGCGTCGCTCACGCTGCAGGTGGACGAGCTGGCAGACAGCGTACACAAACTGGAACAGCGGGTGCTG
GTAGCGGGCGATGAGGCTGCGCTGGTGCTGCGGCTGGCGGCGATGAGGCTGCGGGAGAGAGAGGATAGGGAGAAG
GAGAGCGCTGGGACGAAGGGGATGCCCGTCACCAAGGTGCTCAGAAGCCTGGGCAGGATATTGCCCGAGGGCAGT
GGCGGATAG
Transcript >Ophun1|7125
ATGGCGCATCATTCCCACAACCACGCGACATCGATAGACTCGGGCCGAGCCGCGAGTGAGAATAGCAATATATCG
GAAGAGGGCTCGAAGTCCAAGTCGAGCACGAGAGGCCGAGCCAAGAAGAACAGCGTCAGCAGCAACGGCCGGAGG
AAAGCAGACGAGTTACCGGCAAAACTACCTCCGAGTAAGAAAGGAAAGGGCAACAATGGCATGATGAATGGTGGC
CCGGGTAGTTCTGACGAAGATGAAGATGATGACGACGATGACGATCTCAAGACCAAGATGGAGGATGGCGGCTCC
AAGTCCAAGATGACGGACGAGGAGAAGCGCAAAAACTTCCTCGAGAGGAATCGCGTCGCCGCCCTCAAATGCCGA
CAGCGCAAAAAGCAGTGGCTCGCAAACCTGCAGAACAAGGTCGAGCTTTTCAGCACGGAGAACGACGCCCTGTCG
AATCAGATCACGCAGTTGAAGGAAGAGGTGGTGAATCTCAAGGCGCTTCTGCTAGCTCACAAGGACTGTTCCGTC
ACTCAACAGCACGGCGCCTACATGTCGCAAATGGAGCCATACAACACGCAGATGAACCCGTACGCCGCTGCGGAT
CTGGAGGAGGACGAAGATTTTCAATTTGTTCGCAAGTCGAAACGGCCCAAGAAGGAAGAGCAGGATGCGCCAAAA
CCGGCCAGAAAGACTGGCCGGAAGCCCAAAGCTACGAGAGAGTCGGACATCGTCGAGACTGTACAGCCCGCGTCC
GAGTCGAGACGGTCTTCGAGGAGGAGGGCCAGTGGAGATGGCGAGGCTGATGCGCCACCGGCGGTGAAACGCGCG
ACGAGGCACAGCAAGCGACTTTCTGGCGATGCGCCTGACGAGCTCGAGGGCAATGGCCTGGTCGAAGGAAGGCGG
AGGGCCAAGGGTTCGACGCGACGCGGTGATGACGAGGTGAAGAATAGGCGTACGTCTCGCAGTGGAAACGACAGA
GACCAGGCAGAGACGACATCACGCAGAAGTCCGGACGAGGCGAAGGCGTCGCGCAGCAGCAGCAATAACAACAAG
ACGCGGAAGACGAAGCCGGCCGCGGCCATCCGATCTTCGCCTCAGCAGCCCGCGACATCAGCCATGACGATCGCG
CTACCGATGAGCGACACACCAGTCATCAATCGCAACAAGGAGATGCGCAGAAAGGGGCCGTCCAACCGGCGAAGC
AGCCTGGGCTCGCGCGGCCGGCGGGCTAGTTCACTCATCGATAGCGGCCAGGCTGCACTCCCGCACCGCGAGGTC
GACTCGGCCGACTTTTACAAGCACATCACGGCCGACGGGCTGCCGGAGCCGCGGCGTATGAAACAGCTGCTCATG
TGGTGCGGCGAGCGCGCGCTGTCGGACAAGCCGCCGCACGGCACAGCAGCTTCGAACGCGATCCTTGGCGCTCGC
GCGATCCAGGATCAGCTACTCAAGGACTTTGCTTCCAAGTCGGAGTTTTCCGATTGGTTCAGTAGGGGCGAGGAC
GGGGCCAAGGTTCAGGTCATTCTGAAGCCGAATCCGCGGAATGCGGAGCTTGACGAGAAGATGGAAGCGTTGGAG
GCGAAGATTGCCAGGCTGCGAGAAGAGAAGAGAGCATGGCTAGAGATTCGCAAGCCGCCGCCCGACCTGCCACCG
CTGTTCCCCGATGACTCGACGACGACGGACGCCGTGATACTACCAGACTTTAACCTCCTAGACGACGACGAGGTC
GCCATCGGACGCTTCCTCGCCGACGAGGAGCAATCCTTGGCTGCGGCGCGGACACGGACGGAGGAGCAGCTGCGG
GGGATTCAGGCGTCGCTCACGCTGCAGGTGGACGAGCTGGCAGACAGCGTACACAAACTGGAACAGCGGGTGCTG
GTAGCGGGCGATGAGGCTGCGCTGGTGCTGCGGCTGGCGGCGATGAGGCTGCGGGAGAGAGAGGATAGGGAGAAG
GAGAGCGCTGGGACGAAGGGGATGCCCGTCACCAAGGTGCTCAGAAGCCTGGGCAGGATATTGCCCGAGGGCAGT
GGCGGATAG
Gene >Ophun1|7125
ATGGCGCATCATTCCCACAACCACGCGACATCGATAGACTCGGGCCGAGCCGCGAGTGAGAATAGCAATATATCG
GAAGAGGGCTCGAAGTCCAAGTCGAGCACGAGAGGCCGAGCCAAGAAGAACAGCGTCAGCAGCAACGGCCGGAGG
AAAGCAGACGAGTTACCGGCAAAACTACCTCCGAGTAAGAAAGGAAAGGGCAACAATGGCATGATGAATGGTGGC
CCGGGTAGTTCTGACGAAGATGAAGATGATGACGACGATGACGATCTCAAGACCAAGATGGAGGATGGCGGCTCC
AAGTCCAAGATGACGGACGAGGAGAAGCGCAAAAACTTCCTCGAGAGGAATCGGTAAGTTCGTTCAAGGTTTCGT
CGACCTGATGCGCTGACTCCAAGCCTCGCAGCGTCGCCGCCCTCAAATGCCGACAGCGCAAAAAGCAGTGGCTCG
CAAACCTGCAGAACAAGGTCGAGCTTTTCAGCACGGAGAACGACGCCCTGTCGAATCAGATCACGCAGTTGAAGG
AAGAGGTGGTGAATCTCAAGGCGCTTCTGCTAGCTCACAAGGACTGTTCCGTCACTCAACAGCACGGCGCCTACA
TGTCGCAAATGGAGCCATACAACACGCAGATGAACCCGTACGGTATGGCCGGCCCGATGTCCAACTCCCAAGTCA
TGCCTGGCCAGGGTGCACAGCGTCGATTTCCCTAGTTCGGTTCTCATGATGCTGTCGGTGGACATAGCCTTGAGC
CCTTCAACGCCACTTTGCTGCGCCGTGGCGACGGAGTACCATCTCGCACACCCCTCGGTAGACCCAGCATTGAAA
CCAGCGGCCGGCGCATGTCTGGCTAGCGATTCTGCATTCCATGATGTCTTTGTGTCGAGTTTTGCTGCAGTTGTC
CGAGAGGTCGGTTATAGTGATGACTGACGAAGGGGATTGCGCCGTTCTGGCCGTGTACTCAAAATGGGGTGGATC
AAAAGGAGCGAGCAGGATGAGAAACGGCCCTGCTAGGCGTCACGGATGAGTCCACGACTATAAGGACCTGTTTTG
GCGTTGAAGCGAAGAAACATGTCAGGTCAAGGCGGGCCTCAGTTGGGCCCCCTAATTCAAAAATTATCCATTTCG
ACGATGGCTTCCTGACTCTTTGGATGAAACGAGTCACCTATTTGAGCGTGATGTAGCTTTAGCTAGTGATTTTGA
GCACCAGCAGCAGTGTAATGACCAACTGGGCGAGATGGAATGGACGAGGCAAGTTGAGAAGTTGTCTCTTCAAGG
TCGTAGAGATTCTACAGGGTCTGAAGCTCTTACGTCAGCCGTTCTCGATGAGAGGAGTCGAGCCAATCAGGGTTA
GGCAGCGGCAGCGCATCTTTGCCGCGCCCCGAAAAGGATTAGCGCCGCGGCAGGAAACGACGTCCGAGTCGGGGA
CGTGCCCTTGATTGCGAAGAAGTAAACACACGGCCATTCTCTCCCTCTGGTCTGGAGTCTGGGCTCATTTTGTCT
CTTTGTGCGCGCCGCGCCGAACCTCAGCCGGCGCCCGAGCAGCTGTTCTCGTTCTCGGTCGAGACGAGACGCGAG
TCGTGGGCGGCTACCTGCTGTTTCCTTGTTGACGACGCGTCCGTTTCGTCACGCGACAAGACTGGCGGCAAGGAG
GCGTCGATGACGACTCTCGTGGCGACTGAGGCGTTGCACTTGAGTATGAGCGGACAGTCGAAGCGGCGGACGAGC
AAGCGGCTTGCGGGCAAGTCTTCCTGTTTCCAGTGGTCGGGGTGGAGGAGGGCAATGATTTCAGGAAGCTGACTG
CTGACTGACTAACGAAATAGCCGCTGCGGATCTGGAGGAGGACGAAGATTTTCAATTTGTTCGCAAGTCGAAACG
GCCCAAGAAGGAAGAGCAGGATGCGCCAAAACCGGCCAGAAAGACTGGCCGGAAGCCCAAAGCTACGAGAGAGTC
GGACATCGTCGAGACTGTACAGCCCGCGTCCGAGTCGAGACGGTCTTCGAGGAGGAGGGCCAGTGGAGATGGCGA
GGCTGATGCGCCACCGGCGGTGAAACGCGCGACGAGGCACAGCAAGCGACTTTCTGGCGATGCGCCTGACGAGCT
CGAGGGCAATGGCCTGGTCGAAGGAAGGCGGAGGGCCAAGGGTTCGACGCGACGCGGTGATGACGAGGTGAAGAA
TAGGCGTACGTCTCGCAGTGGAAACGACAGAGACCAGGCAGAGACGACATCACGCAGAAGTCCGGACGAGGCGAA
GGCGTCGCGCAGCAGCAGCAATAACAACAAGACGCGGAAGACGAAGCCGGCCGCGGCCATCCGATCTTCGCCTCA
GCAGCCCGCGACATCAGCCATGACGATCGCGCTACCGATGAGCGACACACCAGTCATCAATCGCAACAAGGAGAT
GCGCAGAAAGGGGCCGTCCAACCGGCGAAGCAGCCTGGGCTCGCGCGGCCGGCGGGCTAGTTCACTCATCGATAG
CGGCCAGGCTGCACTCCCGCACCGCGAGGTCGACTCGGCCGACTTTTACAAGCACATCACGGCCGACGGGCTGCC
GGAGCCGCGGCGTATGAAACAGCTGCTCATGTGGTGCGGCGAGCGCGCGCTGTCGGACAAGCCGCCGCACGGCAC
AGCAGCTTCGAACGCGATCCTTGGCGGTACGTGGGCGTCTGAAGCAGGACGGGGAATGGGGAATGGGGTAGATGC
TGACTTGTTGGCAGCTCGCGCGATCCAGGATCAGCTACTCAAGGACTTTGCTTCCAAGTCGGAGTTTTCCGATTG
GTTCAGTAGGGGCGAGGACGGGGCCAAGGTTCAGGTCATTCTGAAGCCGAATCCGCGGAATGCGGAGCTTGACGA
GAAGATGGAAGCGTTGGAGGCGAAGATTGCCAGGTGCGTTTCTACTTGTCTGGTGACTATCGTGTGCTCGGCTGA
CGAGGCATCACACACATCAGGCTGCGAGAAGAGAAGAGAGCATGGCTAGAGATTCGCAAGCCGCCGCCCGACCTG
CCACCGCTGTTCCCCGATGACTCGACGACGACGGACGCCGTGATACTACCAGACTTTAACCTCCTAGACGACGAC
GAGGTCGCCATCGGACGCTTCCTCGCCGACGAGGAGCAATCCTTGGCTGCGGCGCGGACACGGACGGAGGAGCAG
CTGCGGGGGATTCAGGCGTCGCTCACGCTGCAGGTGGACGAGCTGGCAGACAGCGTACACAAACTGGAACAGCGG
GTGCTGGTAGCGGGCGATGAGGCTGCGCTGGTGCTGCGGCTGGCGGCGATGAGGCTGCGGGAGAGAGAGGATAGG
GAGAAGGAGAGCGCTGGGACGAAGGGGATGCCCGTCACCAAGGTGCTCAGAAGCCTGGGCAGGATATTGCCCGAG
GGCAGTGGCGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail