Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7124
Gene name
LocationContig_857:1641..4561
Strand-
Gene length (bp)2920
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11951 Fungal_trans_2 Fungal specific transcription factor domain 5.0E-23 316 725

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7124
MGDAVEDGPFLDGRPVKRVKVDDDELAPDLWTGPSLTSPFYHHGLSAVSMPAAADVPRPMPWAGIEVEAWPMPGS
APVQPLASQSSPPQSASSALSVPDYHHISSPASPIVSRPSQVSKRPRCLLPPPAGDAPGVVEQRTVNSFGLVSPF
RDCVGIFGQASKRRFARPVDGKVNGYIKFNWPVERPSRRESLVHEDSTSASVVELDDETAAAVEASSSSSSSIVP
FHSASSSVACSSMVALSPDLDSNFDFSGYLYGSSGASSLELLNAVTTMTSPSLVSADGPSEVASMGAPRKVPHLF
GYEAKMDPTDRKFWAFYIKNWCPGRSVLSETNLWLKDFAQMHKSDGVRAAIQSLAGIYIYDYRPLDSVRKRVNDR
FFEAESRLSLLLSDPLTSRSETQANELITISVLLSMQDIVLTERRLRKPHDPRWLAGFKQGEHFLQATDQGSRFW
KRSNAQLSSLRVSQAVIVGRALILAQPMMKLTSPETLDPEYEASRFGWLLYGTERDMYEIHGGCGFSKKLLHIFS
QITYCAARLQQDPHNVVTPTTTRYLYAELLMMRQWSSESKDWEAARAGPSVIEWARSLPFGHVVSSSADMTDVTA
EAWRLAAIIYLQCRVWRFPRNHPDVVETLSDLAQCIRIMPTSGYHFTAQAPLFPVFLLGMLATDVELRNVSKTWF
DEVVSTPVRSSVPPLYEVLQRIWQWIDTSVPLPPLEAPVNVVGLRPAWWETIVHQVDKREPEVLCLT*
Coding >Ophun1|7124
ATGGGCGATGCGGTCGAGGACGGGCCGTTCCTGGATGGTCGGCCTGTCAAGCGCGTCAAGGTCGACGACGACGAG
TTGGCTCCGGATCTCTGGACGGGCCCATCTCTTACATCACCCTTCTATCACCACGGCTTGTCTGCTGTTTCGATG
CCCGCTGCCGCTGATGTGCCCCGGCCGATGCCCTGGGCCGGGATCGAGGTGGAAGCCTGGCCGATGCCGGGTTCG
GCTCCGGTTCAGCCTCTTGCTTCGCAGTCTTCTCCGCCGCAGTCGGCCTCGTCAGCCCTGTCTGTCCCCGACTAC
CACCACATCTCCTCGCCCGCGAGCCCTATAGTCTCCCGTCCCTCCCAAGTGTCCAAGAGGCCGCGCTGCCTGTTG
CCTCCGCCTGCAGGCGATGCCCCCGGCGTCGTGGAGCAGCGAACCGTCAACAGCTTCGGTCTCGTCAGTCCTTTT
AGGGACTGTGTGGGCATCTTCGGACAGGCATCCAAGCGTCGGTTTGCGCGTCCCGTCGACGGCAAGGTCAATGGA
TACATCAAGTTCAACTGGCCCGTCGAGAGGCCATCGCGACGCGAGTCGTTGGTTCACGAGGATTCGACTTCGGCG
TCTGTGGTCGAGCTTGACGATGAGACGGCCGCTGCTGTTGAGGCGTCGTCTTCGTCGTCGTCCTCCATCGTTCCC
TTTCACTCTGCCTCGTCGTCAGTCGCTTGTTCGTCCATGGTCGCCTTGTCGCCAGACCTAGACTCCAACTTTGAC
TTCTCCGGCTATCTCTATGGATCGAGTGGCGCGTCCAGTCTCGAGCTGCTCAACGCCGTGACCACCATGACGAGT
CCGTCTCTCGTCAGCGCTGATGGTCCGTCCGAGGTGGCCTCGATGGGCGCCCCGCGAAAGGTGCCGCATCTGTTT
GGCTACGAAGCCAAGATGGACCCTACAGACCGCAAGTTTTGGGCCTTTTACATCAAGAACTGGTGCCCTGGGAGA
AGCGTCCTCTCCGAGACGAACCTCTGGCTCAAAGACTTTGCCCAGATGCACAAGAGCGACGGTGTGAGAGCCGCC
ATCCAGAGCCTGGCGGGCATCTACATCTACGACTACAGGCCGCTCGACAGCGTCCGCAAGAGGGTCAACGACCGC
TTCTTCGAGGCCGAGTCGCGCCTGAGTCTGTTGTTGAGCGACCCCTTGACCAGCCGCAGCGAGACGCAGGCCAAC
GAGCTGATTACCATCTCGGTGCTGCTCTCCATGCAGGACATCGTCCTCACCGAGCGTCGCCTGCGCAAGCCACAC
GATCCCCGCTGGCTCGCCGGCTTCAAGCAGGGCGAGCACTTCCTCCAGGCGACAGACCAGGGCTCGCGCTTCTGG
AAACGGTCCAACGCCCAGCTGTCGTCCCTTCGCGTCTCGCAGGCCGTCATCGTCGGCCGCGCCCTGATCCTCGCT
CAGCCCATGATGAAGCTGACGTCGCCCGAGACGCTGGACCCGGAGTACGAGGCCTCTCGCTTCGGCTGGCTGCTC
TACGGCACCGAACGAGACATGTACGAGATTCACGGCGGCTGTGGCTTCTCCAAGAAGCTGCTGCACATCTTTAGT
CAAATCACCTACTGCGCCGCCCGCCTGCAGCAGGATCCGCACAACGTCGTGACGCCAACGACGACACGCTATCTG
TACGCAGAGCTCCTCATGATGCGCCAGTGGAGCAGCGAGTCCAAGGACTGGGAAGCGGCCAGGGCCGGCCCGTCG
GTCATCGAGTGGGCGCGCTCCCTGCCCTTTGGTCATGTCGTCAGCTCCTCGGCCGACATGACGGACGTGACGGCC
GAGGCCTGGAGGCTGGCGGCCATCATCTACCTGCAGTGTCGGGTATGGAGATTTCCTCGGAATCATCCGGATGTG
GTCGAGACCCTCTCCGACCTGGCCCAATGCATCCGTATCATGCCGACTTCGGGCTATCACTTTACCGCTCAGGCG
CCGCTCTTCCCCGTCTTCCTCCTCGGCATGCTGGCGACTGACGTCGAGTTGCGCAACGTTTCCAAGACGTGGTTC
GACGAGGTCGTCTCGACGCCGGTCAGGAGTAGCGTTCCGCCCCTATACGAGGTCTTGCAGCGAATATGGCAGTGG
ATCGACACCAGCGTGCCGCTTCCTCCCCTGGAAGCACCCGTCAATGTCGTCGGACTCCGACCCGCGTGGTGGGAG
ACAATCGTTCACCAGGTCGATAAGAGGGAGCCCGAGGTGCTGTGCTTGACGTGA
Transcript >Ophun1|7124
ATGGGCGATGCGGTCGAGGACGGGCCGTTCCTGGATGGTCGGCCTGTCAAGCGCGTCAAGGTCGACGACGACGAG
TTGGCTCCGGATCTCTGGACGGGCCCATCTCTTACATCACCCTTCTATCACCACGGCTTGTCTGCTGTTTCGATG
CCCGCTGCCGCTGATGTGCCCCGGCCGATGCCCTGGGCCGGGATCGAGGTGGAAGCCTGGCCGATGCCGGGTTCG
GCTCCGGTTCAGCCTCTTGCTTCGCAGTCTTCTCCGCCGCAGTCGGCCTCGTCAGCCCTGTCTGTCCCCGACTAC
CACCACATCTCCTCGCCCGCGAGCCCTATAGTCTCCCGTCCCTCCCAAGTGTCCAAGAGGCCGCGCTGCCTGTTG
CCTCCGCCTGCAGGCGATGCCCCCGGCGTCGTGGAGCAGCGAACCGTCAACAGCTTCGGTCTCGTCAGTCCTTTT
AGGGACTGTGTGGGCATCTTCGGACAGGCATCCAAGCGTCGGTTTGCGCGTCCCGTCGACGGCAAGGTCAATGGA
TACATCAAGTTCAACTGGCCCGTCGAGAGGCCATCGCGACGCGAGTCGTTGGTTCACGAGGATTCGACTTCGGCG
TCTGTGGTCGAGCTTGACGATGAGACGGCCGCTGCTGTTGAGGCGTCGTCTTCGTCGTCGTCCTCCATCGTTCCC
TTTCACTCTGCCTCGTCGTCAGTCGCTTGTTCGTCCATGGTCGCCTTGTCGCCAGACCTAGACTCCAACTTTGAC
TTCTCCGGCTATCTCTATGGATCGAGTGGCGCGTCCAGTCTCGAGCTGCTCAACGCCGTGACCACCATGACGAGT
CCGTCTCTCGTCAGCGCTGATGGTCCGTCCGAGGTGGCCTCGATGGGCGCCCCGCGAAAGGTGCCGCATCTGTTT
GGCTACGAAGCCAAGATGGACCCTACAGACCGCAAGTTTTGGGCCTTTTACATCAAGAACTGGTGCCCTGGGAGA
AGCGTCCTCTCCGAGACGAACCTCTGGCTCAAAGACTTTGCCCAGATGCACAAGAGCGACGGTGTGAGAGCCGCC
ATCCAGAGCCTGGCGGGCATCTACATCTACGACTACAGGCCGCTCGACAGCGTCCGCAAGAGGGTCAACGACCGC
TTCTTCGAGGCCGAGTCGCGCCTGAGTCTGTTGTTGAGCGACCCCTTGACCAGCCGCAGCGAGACGCAGGCCAAC
GAGCTGATTACCATCTCGGTGCTGCTCTCCATGCAGGACATCGTCCTCACCGAGCGTCGCCTGCGCAAGCCACAC
GATCCCCGCTGGCTCGCCGGCTTCAAGCAGGGCGAGCACTTCCTCCAGGCGACAGACCAGGGCTCGCGCTTCTGG
AAACGGTCCAACGCCCAGCTGTCGTCCCTTCGCGTCTCGCAGGCCGTCATCGTCGGCCGCGCCCTGATCCTCGCT
CAGCCCATGATGAAGCTGACGTCGCCCGAGACGCTGGACCCGGAGTACGAGGCCTCTCGCTTCGGCTGGCTGCTC
TACGGCACCGAACGAGACATGTACGAGATTCACGGCGGCTGTGGCTTCTCCAAGAAGCTGCTGCACATCTTTAGT
CAAATCACCTACTGCGCCGCCCGCCTGCAGCAGGATCCGCACAACGTCGTGACGCCAACGACGACACGCTATCTG
TACGCAGAGCTCCTCATGATGCGCCAGTGGAGCAGCGAGTCCAAGGACTGGGAAGCGGCCAGGGCCGGCCCGTCG
GTCATCGAGTGGGCGCGCTCCCTGCCCTTTGGTCATGTCGTCAGCTCCTCGGCCGACATGACGGACGTGACGGCC
GAGGCCTGGAGGCTGGCGGCCATCATCTACCTGCAGTGTCGGGTATGGAGATTTCCTCGGAATCATCCGGATGTG
GTCGAGACCCTCTCCGACCTGGCCCAATGCATCCGTATCATGCCGACTTCGGGCTATCACTTTACCGCTCAGGCG
CCGCTCTTCCCCGTCTTCCTCCTCGGCATGCTGGCGACTGACGTCGAGTTGCGCAACGTTTCCAAGACGTGGTTC
GACGAGGTCGTCTCGACGCCGGTCAGGAGTAGCGTTCCGCCCCTATACGAGGTCTTGCAGCGAATATGGCAGTGG
ATCGACACCAGCGTGCCGCTTCCTCCCCTGGAAGCACCCGTCAATGTCGTCGGACTCCGACCCGCGTGGTGGGAG
ACAATCGTTCACCAGGTCGATAAGAGGGAGCCCGAGGTGCTGTGCTTGACGTGA
Gene >Ophun1|7124
ATGGGCGATGCGGTCGAGGACGGGCCGTTCCTGGATGGTCGGCCTGTCAAGCGCGTCAAGGTCGACGACGACGAG
TTGGCTCCGGATCTCTGGACGGGCCCATCTCTTACATCACCCTTCTATCACCACGGCTTGTCTGCTGTTTCGATG
CCCGCTGCCGCTGATGTGCCCCGGCCGATGCCCTGGGCCGGGATCGAGGTGGAAGCCTGGCCGATGCCGGGTTCG
GCTCCGGTTCAGCCTCTTGCTTCGCAGTCTTCTCCGCCGCAGTCGGCCTCGTCAGGTGAGAGGAGCTTTTTTTTT
TTTCTTCCTTTCCCCTTTCTCTCTCTCTCTCTCTCTCTCTCTTTCTGTCCTTCTCCTTCTATCCCTGACCTGTCA
CCCACGTCATATGCCACGGTCAAGGCCTTTCAGCTTGTGCAACGTCACACCGTCCTTGTCTGGTTCCCTGCTTCA
TCCTCCTTCCTGCTTCCGATCTGTTGGGCCTGCAGCGGCATCTCTTCCTTCGTTCCCCTTCCCGGCTCCCCGGTT
TACGGCCGCTAAGACACACGAAACAACTCCTTTCATCCTCCTCCTCCGCCTCCTCCTCCTCCCCCCCCCAAATCG
ATCTGACGCCGGATGCTACCTTACATGCTTATCGACCTGGTGCCACCCACCTCGCACATGAATATTAGACGTCAT
GATGAACTGACAGCCGCCAGCCCTGTCTGTCCCCGACTACCACCACATCTCCTCGCCCGCGAGCCCTATAGTCTC
CCGTCCCTCCCAAGTGTCCAAGAGGCCGCGCTGCCTGTTGCCTCCGCCTGCAGGCGATGCCCCCGGCGTCGTGGA
GCAGCGAACCGTCAACAGCTTCGGTCTCGTCAGTCCTTTTAGGGACTGTGTGGGCATCTTCGGACAGGCATCCAA
GCGTCGGTTTGCGCGTCCCGTCGACGGCAAGGTCAATGGATACATCAAGTTCAACTGGCCCGTCGAGAGGCCATC
GCGACGCGAGTCGTTGGTTCACGAGGATTCGACTTCGGCGTCTGTGGTCGAGCTTGACGATGAGACGGCCGCTGC
TGTTGAGGCGTCGTCTTCGTCGTCGTCCTCCATCGTTCCCTTTCACTCTGCCTCGTCGTCAGTCGCTTGTTCGTC
CATGGTCGCCTTGTCGCCAGACCTAGACTCCAACTTTGACTTCTCCGGCTATCTCTATGGATCGAGTGGCGCGTC
CAGTCTCGAGCTGCTCAACGCCGTGACCACCATGACGAGTCCGTCTCTCGTCAGCGCTGATGGTCCGTCCGAGGT
GGCCTCGATGGGCGCCCCGCGAAAGGTGCCGCATCTGTTTGGCTACGAAGCCAAGATGGACCCTACAGACCGCAA
GTTTTGGGCCTTTTGTATGTCATCTTGTTCTCTTCCCTTCCCACAGCTCTGCCCGAGGAGGTGGTGATGGCGTCA
CGGAATGACTAACCCCGGGAAAACAAAATCGCGGCAGACATCAAGAACTGGTGCCCTGGGAGAAGCGTCCTCTCC
GAGACGAACCTCTGGCTCAAAGACTTTGCCCAGATGCACAAGAGCGACGGTGTGAGAGCCGCCATCCAGAGCCTG
GCGGGCATCTACATCTACGACTACAGGCCGCTCGACAGCGTCCGCAAGAGGGTCAACGACCGCTTCTTCGAGGCC
GAGTCGCGCCTGAGTCTGTTGTTGAGCGACCCCTTGACCAGCCGCAGCGAGACGCAGGCCAACGAGCTGATTACC
ATCTCGGTGCTGCTCTCCATGCAGGACGTGAGTAGATGCTTCAAGTCTCCCTCCGGCTCACCTTGACATTCACTG
ACCCCGGCAGATCGTCCTCACCGAGCGTCGCCTGCGCAAGCCACACGATCCCCGCTGGCTCGCCGGCTTCAAGCA
GGGCGAGCACTTCCTCCAGGCGACAGACCAGGGCTCGCGCTTCTGGAAACGGTCCAACGCCCAGCTGTCGTCCCT
TCGCGTCTCGCAGGCCGTCATCGTCGGCCGCGCCCTGATCCTCGCTCAGCCCATGATGAAGCTGACGTCGCCCGA
GACGCTGGACCCGGAGTACGAGGCCTCTCGCTTCGGCTGGCTGCTCTACGGCACCGAACGAGACATGTACGAGAT
TCACGGCGGCTGTGGCTTCTCCAAGAAGCTGCTGCACATCTTTAGTCAAATCACCTACTGCGCCGCCCGCCTGCA
GCAGGATCCGCACAACGTCGTGACGCCAACGACGACACGCTATCTGTACGCAGAGCTCCTCATGATGCGCCAGTG
GAGCAGCGAGTCCAAGGACTGGGAAGCGGCCAGGGCCGGCCCGTCGGTCATCGAGTGGGCGCGCTCCCTGCCCTT
TGGTCATGTCGTCAGCTCCTCGGCCGACATGACGGACGTGACGGCCGAGGCCTGGAGGCTGGCGGCCATCATCTA
CCTGCAGTGTCGGGTATGGAGGTATGCAAACTTGCCGTTTCCCCCCCTGATCCCATCTGATCCGCCTCAGATTTC
CTCGGAATCATCCGGATGTGGTCGAGACCCTCTCCGACCTGGCCCAATGCATCCGTATCATGCCGACTTCGGGCT
ATCACTTTACCGCTCAGGCGCCGCTCTTCCCCGTCTTCCTCCTCGGCATGCTGGCGACTGACGTCGAGTTGCGCA
ACGTTTCCAAGACGTGGTTCGACGAGGTCGTCTCGACGCCGGTCAGGAGTGTGAGTTTCCCTGCCATTCCACCTC
GTCTGGTAGTACCTAGTTGATGGCTAATGACGTCCTACGCGAACAGAGCGTTCCGCCCCTATACGAGGTCTTGCA
GCGAATATGGCAGTGGATCGACACCAGCGTGCCGCTTCCTCCCCTGGAAGCACCCGTCAATGTCGTCGGACTCCG
ACCCGCGTGGTGGGAGACAATCGTTCACCAGGTCGATAAGAGGGAGCCCGAGGTGCTGTGCTTGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail