Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7108
Gene name
LocationContig_85:33731..37034
Strand-
Gene length (bp)3303
Transcript length (bp)3243
Coding sequence length (bp)3243
Protein length (aa) 1081

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00488 MutS_V MutS domain V 8.2E-72 844 1043
PF05192 MutS_III MutS domain III 5.3E-37 490 790
PF01624 MutS_I MutS domain I 1.8E-29 176 301
PF05188 MutS_II MutS domain II 2.1E-11 317 470
PF05190 MutS_IV MutS family domain IV 1.4E-04 672 747

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFD4|MSH3_CHAGB DNA mismatch repair protein MSH3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MSH3 PE=3 SV=1 9 1080 0.0E+00
sp|Q7SD11|MSH3_NEUCR DNA mismatch repair protein msh-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msh-3 PE=3 SV=1 9 1080 0.0E+00
sp|A4R0R0|MSH3_MAGO7 DNA mismatch repair protein MSH3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MSH3 PE=3 SV=1 1 1080 0.0E+00
sp|A6RPB6|MSH3_BOTFB DNA mismatch repair protein msh3 OS=Botryotinia fuckeliana (strain B05.10) GN=msh3 PE=3 SV=2 9 1080 0.0E+00
sp|A7EC69|MSH3_SCLS1 DNA mismatch repair protein msh3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=msh3 PE=3 SV=1 6 1080 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFD4|MSH3_CHAGB DNA mismatch repair protein MSH3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MSH3 PE=3 SV=1 9 1080 0.0E+00
sp|Q7SD11|MSH3_NEUCR DNA mismatch repair protein msh-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msh-3 PE=3 SV=1 9 1080 0.0E+00
sp|A4R0R0|MSH3_MAGO7 DNA mismatch repair protein MSH3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MSH3 PE=3 SV=1 1 1080 0.0E+00
sp|A6RPB6|MSH3_BOTFB DNA mismatch repair protein msh3 OS=Botryotinia fuckeliana (strain B05.10) GN=msh3 PE=3 SV=2 9 1080 0.0E+00
sp|A7EC69|MSH3_SCLS1 DNA mismatch repair protein msh3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=msh3 PE=3 SV=1 6 1080 0.0E+00
sp|A2R1F6|MSH3_ASPNC DNA mismatch repair protein msh3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=msh3 PE=3 SV=2 4 1080 0.0E+00
sp|Q5B6T1|MSH3_EMENI DNA mismatch repair protein msh3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=msh3 PE=3 SV=2 10 1080 0.0E+00
sp|Q1DQ73|MSH3_COCIM DNA mismatch repair protein MSH3 OS=Coccidioides immitis (strain RS) GN=MSH3 PE=3 SV=2 10 1080 0.0E+00
sp|Q0CPP9|MSH3_ASPTN DNA mismatch repair protein msh3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=msh3 PE=3 SV=1 10 1080 0.0E+00
sp|Q2UT70|MSH3_ASPOR DNA mismatch repair protein msh3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=msh3 PE=3 SV=1 66 1080 0.0E+00
sp|A1CDD4|MSH3_ASPCL DNA mismatch repair protein msh3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=msh3 PE=3 SV=1 81 1080 0.0E+00
sp|Q4WGB7|MSH3_ASPFU DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=msh3 PE=3 SV=1 10 1040 0.0E+00
sp|B0YCF6|MSH3_ASPFC DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=msh3 PE=3 SV=1 10 1040 0.0E+00
sp|A1DCB2|MSH3_NEOFI DNA mismatch repair protein msh3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=msh3 PE=3 SV=1 10 1040 0.0E+00
sp|A6R7S1|MSH3_AJECN DNA mismatch repair protein MSH3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MSH3 PE=3 SV=2 94 1080 0.0E+00
sp|Q0UXL8|MSH3_PHANO DNA mismatch repair protein MSH3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSH3 PE=3 SV=3 12 1080 0.0E+00
sp|P20585|MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens GN=MSH3 PE=1 SV=4 163 1052 0.0E+00
sp|P13705|MSH3_MOUSE DNA mismatch repair protein Msh3 OS=Mus musculus GN=Msh3 PE=2 SV=3 158 1052 0.0E+00
sp|P0CO93|MSH3_CRYNB DNA mismatch repair protein MSH3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MSH3 PE=3 SV=1 176 1049 0.0E+00
sp|P0CO92|MSH3_CRYNJ DNA mismatch repair protein MSH3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MSH3 PE=3 SV=1 176 1049 0.0E+00
sp|Q4P6I8|MSH3_USTMA DNA mismatch repair protein MSH3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MSH3 PE=3 SV=1 131 1042 0.0E+00
sp|P26359|MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh3 PE=3 SV=1 164 1050 2.0E-179
sp|Q6BW83|MSH3_DEBHA DNA mismatch repair protein MSH3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MSH3 PE=3 SV=2 136 1080 3.0E-176
sp|Q6CHE5|MSH3_YARLI DNA mismatch repair protein MSH3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MSH3 PE=3 SV=1 171 1061 3.0E-173
sp|O65607|MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana GN=MSH3 PE=1 SV=2 160 1049 8.0E-171
sp|Q1ZXH0|MSH3_DICDI DNA mismatch repair protein Msh3 OS=Dictyostelium discoideum GN=msh3 PE=3 SV=1 153 1077 8.0E-165
sp|Q759V4|MSH3_ASHGO DNA mismatch repair protein MSH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MSH3 PE=3 SV=1 63 1077 7.0E-155
sp|A5DEV6|MSH3_PICGU DNA mismatch repair protein MSH3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MSH3 PE=3 SV=2 147 1060 2.0E-151
sp|Q6CSR1|MSH3_KLULA DNA mismatch repair protein MSH3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MSH3 PE=3 SV=1 170 1080 2.0E-146
sp|A7TTQ1|MSH3_VANPO DNA mismatch repair protein MSH3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MSH3 PE=3 SV=1 148 1074 3.0E-143
sp|A3LU10|MSH3_PICST DNA mismatch repair protein MSH3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MSH3 PE=3 SV=3 164 1071 3.0E-138
sp|Q6FVN6|MSH3_CANGA DNA mismatch repair protein MSH3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MSH3 PE=3 SV=1 146 1066 1.0E-137
sp|A5DYV8|MSH3_LODEL DNA mismatch repair protein MSH3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MSH3 PE=3 SV=1 168 1045 2.0E-137
sp|P25336|MSH3_YEAST DNA mismatch repair protein MSH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH3 PE=1 SV=2 163 1042 3.0E-132
sp|A6ZTR3|MSH3_YEAS7 DNA mismatch repair protein MSH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MSH3 PE=3 SV=2 163 1042 3.0E-132
sp|Q59Y41|MSH3_CANAL DNA mismatch repair protein MSH3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MSH3 PE=3 SV=1 168 1049 2.0E-127
sp|O74502|MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh6 PE=1 SV=1 173 1043 3.0E-101
sp|Q8RA71|MUTS_CALS4 DNA mismatch repair protein MutS OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 175 1045 8.0E-97
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 175 1080 5.0E-94
sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana GN=MSH6 PE=1 SV=2 174 1043 2.0E-93
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 174 1045 5.0E-92
sp|A3DDI3|MUTS_CLOTH DNA mismatch repair protein MutS OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mutS PE=3 SV=1 173 1049 9.0E-92
sp|Q97I19|MUTS_CLOAB DNA mismatch repair protein MutS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutS PE=3 SV=1 175 1032 2.0E-89
sp|B9MJU0|MUTS_CALBD DNA mismatch repair protein MutS OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=mutS PE=3 SV=1 174 1059 1.0E-88
sp|B8I2Q5|MUTS_CLOCE DNA mismatch repair protein MutS OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=mutS PE=3 SV=1 175 1065 2.0E-87
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 174 1049 9.0E-87
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 175 1054 1.0E-86
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 175 1054 1.0E-86
sp|Q12VC9|MUTS_METBU DNA mismatch repair protein MutS OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mutS PE=3 SV=1 174 1031 1.0E-86
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 176 1043 1.0E-86
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 176 1043 1.0E-86
sp|B8CX98|MUTS_HALOH DNA mismatch repair protein MutS OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutS PE=3 SV=1 173 1043 2.0E-86
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 176 1043 6.0E-86
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 175 1043 1.0E-85
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 175 1043 2.0E-85
sp|A6TR79|MUTS_ALKMQ DNA mismatch repair protein MutS OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS PE=3 SV=1 173 1043 2.0E-85
sp|Q8DRW8|MUTS_STRMU DNA mismatch repair protein MutS OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutS PE=3 SV=1 174 1043 5.0E-85
sp|Q12PY3|MUTS_SHEDO DNA mismatch repair protein MutS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutS PE=3 SV=1 174 1043 1.0E-84
sp|A9KL10|MUTS_CLOPH DNA mismatch repair protein MutS OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS PE=3 SV=1 173 1032 1.0E-84
sp|A6LWJ5|MUTS_CLOB8 DNA mismatch repair protein MutS OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutS PE=3 SV=1 175 1035 3.0E-84
sp|Q5M6I1|MUTS_STRT2 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutS PE=3 SV=1 174 1043 3.0E-84
sp|Q5M1Z0|MUTS_STRT1 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutS PE=3 SV=1 174 1043 4.0E-84
sp|Q03MY4|MUTS_STRTD DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutS PE=3 SV=1 174 1043 4.0E-84
sp|P73769|MUTS_SYNY3 DNA mismatch repair protein MutS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutS PE=3 SV=2 174 1043 6.0E-84
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 173 1043 6.0E-84
sp|Q3ZYA0|MUTS_DEHMC DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain CBDB1) GN=mutS PE=3 SV=1 176 1065 1.0E-83
sp|Q0AYB5|MUTS_SYNWW DNA mismatch repair protein MutS OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutS PE=3 SV=1 173 1032 1.0E-83
sp|Q03834|MSH6_YEAST DNA mismatch repair protein MSH6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH6 PE=1 SV=1 50 1043 4.0E-83
sp|A6LLR1|MUTS_THEM4 DNA mismatch repair protein MutS OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutS PE=3 SV=1 174 1047 4.0E-83
sp|C0ZEZ4|MUTS_BREBN DNA mismatch repair protein MutS OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutS PE=3 SV=1 173 1043 5.0E-83
sp|Q048Y4|MUTS_LACDB DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutS PE=3 SV=1 176 1048 7.0E-83
sp|Q99XL8|MUTS_STRP1 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M1 GN=mutS PE=3 SV=1 174 1047 7.0E-83
sp|Q46CE2|MUTS_METBF DNA mismatch repair protein MutS OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mutS PE=3 SV=1 175 1043 9.0E-83
sp|Q3ACA5|MUTS_CARHZ DNA mismatch repair protein MutS OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutS PE=3 SV=1 175 1043 9.0E-83
sp|Q48QT6|MUTS_STRPM DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mutS PE=3 SV=1 174 1047 1.0E-82
sp|P0DC61|MUTS_STRPQ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutS PE=3 SV=1 174 1047 1.0E-82
sp|P0DC60|MUTS_STRP3 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutS PE=3 SV=1 174 1047 1.0E-82
sp|Q60BA1|MUTS_METCA DNA mismatch repair protein MutS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutS PE=3 SV=1 176 1054 2.0E-82
sp|Q1JEH0|MUTS_STRPD DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mutS PE=3 SV=1 174 1047 4.0E-82
sp|B5XJ75|MUTS_STRPZ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutS PE=3 SV=1 174 1047 4.0E-82
sp|Q1J489|MUTS_STRPF DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mutS PE=3 SV=1 174 1047 5.0E-82
sp|Q1JJH0|MUTS_STRPC DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutS PE=3 SV=1 174 1047 7.0E-82
sp|Q1J9C1|MUTS_STRPB DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutS PE=3 SV=1 174 1047 7.0E-82
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 170 1035 9.0E-82
sp|Q1G938|MUTS_LACDA DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutS PE=3 SV=1 176 1043 1.0E-81
sp|Q5UZG9|MUTS1_HALMA DNA mismatch repair protein MutS 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS1 PE=3 SV=2 181 1033 3.0E-81
sp|A2RGX2|MUTS_STRPG DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutS PE=3 SV=1 174 1047 4.0E-81
sp|Q5X9F3|MUTS_STRP6 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutS PE=3 SV=1 174 1047 4.0E-81
sp|Q3IDC8|MUTS_PSEHT DNA mismatch repair protein MutS OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutS PE=3 SV=1 176 1043 5.0E-81
sp|Q8NZ24|MUTS_STRP8 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutS PE=3 SV=1 174 1080 6.0E-81
sp|B9DW73|MUTS_STRU0 DNA mismatch repair protein MutS OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mutS PE=3 SV=1 173 1043 8.0E-81
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 176 1043 1.0E-80
sp|A4SIL2|MUTS_AERS4 DNA mismatch repair protein MutS OS=Aeromonas salmonicida (strain A449) GN=mutS PE=3 SV=1 176 1043 3.0E-80
sp|Q8EBR9|MUTS_SHEON DNA mismatch repair protein MutS OS=Shewanella oneidensis (strain MR-1) GN=mutS PE=3 SV=1 174 1067 3.0E-80
sp|Q24X61|MUTS_DESHY DNA mismatch repair protein MutS OS=Desulfitobacterium hafniense (strain Y51) GN=mutS PE=3 SV=1 172 1050 4.0E-80
sp|Q0TRD6|MUTS_CLOP1 DNA mismatch repair protein MutS OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutS PE=3 SV=1 174 1056 4.0E-80
sp|C4L191|MUTS_EXISA DNA mismatch repair protein MutS OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mutS PE=3 SV=1 176 1043 4.0E-80
sp|A5ILG0|MUTS_THEP1 DNA mismatch repair protein MutS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mutS PE=3 SV=1 174 1035 6.0E-80
sp|Q8XL87|MUTS_CLOPE DNA mismatch repair protein MutS OS=Clostridium perfringens (strain 13 / Type A) GN=mutS PE=3 SV=1 174 1056 8.0E-80
sp|A0KU91|MUTS_SHESA DNA mismatch repair protein MutS OS=Shewanella sp. (strain ANA-3) GN=mutS PE=3 SV=1 174 1054 9.0E-80
sp|Q0HL63|MUTS_SHESM DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-4) GN=mutS PE=3 SV=1 174 1043 1.0E-79
sp|A8YTH9|MUTS_LACH4 DNA mismatch repair protein MutS OS=Lactobacillus helveticus (strain DPC 4571) GN=mutS PE=3 SV=1 178 1032 2.0E-79
sp|A2RP10|MUTS_LACLM DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutS PE=3 SV=1 437 1035 2.0E-79
sp|A6WR19|MUTS_SHEB8 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS185) GN=mutS PE=3 SV=1 174 1067 2.0E-79
sp|Q0STR4|MUTS_CLOPS DNA mismatch repair protein MutS OS=Clostridium perfringens (strain SM101 / Type A) GN=mutS PE=3 SV=1 175 1056 3.0E-79
sp|Q31F87|MUTS_THICR DNA mismatch repair protein MutS OS=Thiomicrospira crunogena (strain XCL-2) GN=mutS PE=3 SV=1 170 1043 4.0E-79
sp|A0LG76|MUTS_SYNFM DNA mismatch repair protein MutS OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutS PE=3 SV=1 174 1043 4.0E-79
sp|A5FQC0|MUTS_DEHMB DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mutS PE=3 SV=1 176 1065 4.0E-79
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 176 1032 4.0E-79
sp|A8MFD4|MUTS_ALKOO DNA mismatch repair protein MutS OS=Alkaliphilus oremlandii (strain OhILAs) GN=mutS PE=3 SV=2 174 1060 4.0E-79
sp|Q21LB1|MUTS_SACD2 DNA mismatch repair protein MutS OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutS PE=3 SV=1 176 1032 5.0E-79
sp|Q67NK1|MUTS_SYMTH DNA mismatch repair protein MutS OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutS PE=3 SV=1 172 1043 5.0E-79
sp|A8F753|MUTS_PSELT DNA mismatch repair protein MutS OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutS PE=3 SV=1 174 1047 5.0E-79
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 181 1048 6.0E-79
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 175 1047 7.0E-79
sp|Q15QR9|MUTS_PSEA6 DNA mismatch repair protein MutS OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mutS PE=3 SV=1 159 1043 8.0E-79
sp|P61668|MUTS_LACJO DNA mismatch repair protein MutS OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutS PE=3 SV=1 176 1057 1.0E-78
sp|Q02VS3|MUTS_LACLS DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutS PE=3 SV=1 437 1035 1.0E-78
sp|B8E8U0|MUTS_SHEB2 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS223) GN=mutS PE=3 SV=1 174 1067 1.0E-78
sp|Q3B0S2|MUTS_SYNS9 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9902) GN=mutS PE=3 SV=1 146 1035 1.0E-78
sp|B1LAW3|MUTS_THESQ DNA mismatch repair protein MutS OS=Thermotoga sp. (strain RQ2) GN=mutS PE=3 SV=1 174 1035 2.0E-78
sp|A1RHG2|MUTS_SHESW DNA mismatch repair protein MutS OS=Shewanella sp. (strain W3-18-1) GN=mutS PE=3 SV=1 174 1067 2.0E-78
sp|A4Y934|MUTS_SHEPC DNA mismatch repair protein MutS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mutS PE=3 SV=1 174 1067 2.0E-78
sp|C0MAS5|MUTS_STRE4 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. equi (strain 4047) GN=mutS PE=3 SV=1 479 1073 2.0E-78
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 176 1043 3.0E-78
sp|Q5FLX5|MUTS_LACAC DNA mismatch repair protein MutS OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutS PE=3 SV=1 178 1032 3.0E-78
sp|Q0HXG1|MUTS_SHESR DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-7) GN=mutS PE=3 SV=1 174 1043 3.0E-78
sp|Q82ZA2|MUTS_ENTFA DNA mismatch repair protein MutS OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutS PE=3 SV=1 171 1043 4.0E-78
sp|P52701|MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 176 1080 4.0E-78
sp|C0MGC5|MUTS_STRS7 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutS PE=3 SV=1 466 1073 5.0E-78
sp|A3D786|MUTS_SHEB5 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mutS PE=3 SV=1 174 1067 5.0E-78
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 172 1043 5.0E-78
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 174 1043 7.0E-78
sp|A9KYG1|MUTS_SHEB9 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS195) GN=mutS PE=3 SV=1 174 1067 7.0E-78
sp|Q18FJ9|MUTS_HALWD DNA mismatch repair protein MutS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mutS PE=3 SV=1 158 1035 9.0E-78
sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutS PE=3 SV=1 176 1043 1.0E-77
sp|Q187T6|MUTS_PEPD6 DNA mismatch repair protein MutS OS=Peptoclostridium difficile (strain 630) GN=mutS PE=3 SV=2 174 1043 1.0E-77
sp|A8AZU4|MUTS_STRGC DNA mismatch repair protein MutS OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutS PE=3 SV=1 458 1048 1.0E-77
sp|Q086A1|MUTS_SHEFN DNA mismatch repair protein MutS OS=Shewanella frigidimarina (strain NCIMB 400) GN=mutS PE=3 SV=1 174 1043 1.0E-77
sp|C1DSR1|MUTS_AZOVD DNA mismatch repair protein MutS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutS PE=3 SV=1 176 1043 1.0E-77
sp|Q9CDK9|MUTS_LACLA DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutS PE=3 SV=1 415 1035 1.0E-77
sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mutS PE=3 SV=1 176 1032 1.0E-77
sp|B1I9E5|MUTS_STRPI DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutS PE=3 SV=1 174 1043 2.0E-77
sp|Q8PWA7|MUTS_METMA DNA mismatch repair protein MutS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mutS PE=3 SV=1 175 1043 2.0E-77
sp|P27345|MUTS_AZOVI DNA mismatch repair protein MutS OS=Azotobacter vinelandii GN=mutS PE=3 SV=1 176 1043 2.0E-77
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 176 1070 3.0E-77
sp|B0CF30|MUTS_ACAM1 DNA mismatch repair protein MutS OS=Acaryochloris marina (strain MBIC 11017) GN=mutS PE=3 SV=1 175 1043 5.0E-77
sp|Q3M892|MUTS_ANAVT DNA mismatch repair protein MutS OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutS PE=3 SV=1 174 1043 6.0E-77
sp|B0TK13|MUTS_SHEHH DNA mismatch repair protein MutS OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutS PE=3 SV=1 174 1043 6.0E-77
sp|C1CTY2|MUTS_STRZT DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutS PE=3 SV=1 174 1043 7.0E-77
sp|C1CN23|MUTS_STRZP DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain P1031) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|C1CH06|MUTS_STRZJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain JJA) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|B8ZPK0|MUTS_STRPJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|C1CAQ5|MUTS_STRP7 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain 70585) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|Q04I96|MUTS_STRP2 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|P0A3R4|HEXA_STRR6 DNA mismatch repair protein HexA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexA PE=3 SV=1 174 1043 8.0E-77
sp|P0A3R3|HEXA_STRPN DNA mismatch repair protein HexA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexA PE=3 SV=1 174 1043 8.0E-77
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 174 1035 8.0E-77
sp|B1KPS7|MUTS_SHEWM DNA mismatch repair protein MutS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutS PE=3 SV=1 174 1043 8.0E-77
sp|Q31KZ2|MUTS_SYNE7 DNA mismatch repair protein MutS OS=Synechococcus elongatus (strain PCC 7942) GN=mutS PE=3 SV=1 174 1080 8.0E-77
sp|A8H1T4|MUTS_SHEPA DNA mismatch repair protein MutS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutS PE=3 SV=1 174 1043 1.0E-76
sp|Q2JIA6|MUTS_SYNJB DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mutS PE=3 SV=1 172 1043 1.0E-76
sp|A3CR17|MUTS_STRSV DNA mismatch repair protein MutS OS=Streptococcus sanguinis (strain SK36) GN=mutS PE=3 SV=1 477 1043 1.0E-76
sp|Q5N0X9|MUTS_SYNP6 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mutS PE=3 SV=1 174 1080 1.0E-76
sp|Q8TTB4|MUTS_METAC DNA mismatch repair protein MutS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mutS PE=3 SV=1 175 1043 1.0E-76
sp|A4VJN9|MUTS_PSEU5 DNA mismatch repair protein MutS OS=Pseudomonas stutzeri (strain A1501) GN=mutS PE=3 SV=2 167 1043 2.0E-76
sp|Q6LMU0|MUTS_PHOPR DNA mismatch repair protein MutS OS=Photobacterium profundum GN=mutS PE=3 SV=1 176 1043 2.0E-76
sp|A8ZXH5|MUTS_DESOH DNA mismatch repair protein MutS OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mutS PE=3 SV=1 176 1032 3.0E-76
sp|A0KPG5|MUTS_AERHH DNA mismatch repair protein MutS OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mutS PE=3 SV=1 176 1043 3.0E-76
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 173 1035 4.0E-76
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 173 1035 4.0E-76
sp|B5E385|MUTS_STRP4 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutS PE=3 SV=1 174 1043 4.0E-76
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 176 1035 7.0E-76
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 176 1035 7.0E-76
sp|Q5UYI1|MUTS2_HALMA DNA mismatch repair protein MutS 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS2 PE=3 SV=2 175 1033 1.0E-75
sp|A1T004|MUTS_PSYIN DNA mismatch repair protein MutS OS=Psychromonas ingrahamii (strain 37) GN=mutS PE=3 SV=1 176 1044 1.0E-75
sp|A6V1G8|MUTS_PSEA7 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain PA7) GN=mutS PE=3 SV=1 176 1043 1.0E-75
sp|Q5X4B2|MUTS_LEGPA DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Paris) GN=mutS PE=3 SV=1 176 1035 2.0E-75
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 176 1043 2.0E-75
sp|Q9HY08|MUTS_PSEAE DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutS PE=3 SV=1 176 1043 2.0E-75
sp|Q02R92|MUTS_PSEAB DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutS PE=3 SV=1 176 1043 2.0E-75
sp|A3QC86|MUTS_SHELP DNA mismatch repair protein MutS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutS PE=3 SV=1 174 1043 3.0E-75
sp|Q5WVP6|MUTS_LEGPL DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Lens) GN=mutS PE=3 SV=1 176 1035 3.0E-75
sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein MutS OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutS PE=3 SV=1 174 1043 3.0E-75
sp|B9LB04|MUTS_CHLSY DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mutS PE=3 SV=1 181 1043 3.0E-75
sp|A9WFZ9|MUTS_CHLAA DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutS PE=3 SV=1 181 1043 3.0E-75
sp|B7V8C8|MUTS_PSEA8 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain LESB58) GN=mutS PE=3 SV=1 176 1043 3.0E-75
sp|Q7UA23|MUTS_SYNPX DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH8102) GN=mutS PE=3 SV=1 139 1035 4.0E-75
sp|B1N025|MUTS_LEUCK DNA mismatch repair protein MutS OS=Leuconostoc citreum (strain KM20) GN=mutS PE=3 SV=1 176 1043 4.0E-75
sp|P54276|MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus GN=Msh6 PE=1 SV=3 176 1043 4.0E-75
sp|Q7V978|MUTS_PROMM DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9313) GN=mutS PE=3 SV=1 145 1045 4.0E-75
sp|A8ANU8|MUTS_CITK8 DNA mismatch repair protein MutS OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutS PE=3 SV=1 176 1043 5.0E-75
sp|A5UE20|MUTS_HAEIE DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain PittEE) GN=mutS PE=3 SV=1 176 1043 5.0E-75
sp|Q1D5J6|MUTS_MYXXD DNA mismatch repair protein MutS OS=Myxococcus xanthus (strain DK 1622) GN=mutS PE=3 SV=1 173 1035 6.0E-75
sp|A1S4E6|MUTS_SHEAM DNA mismatch repair protein MutS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutS PE=3 SV=1 174 1043 8.0E-75
sp|Q8PMX2|MUTS_XANAC DNA mismatch repair protein MutS OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutS PE=3 SV=1 158 1043 8.0E-75
sp|C3LS25|MUTS_VIBCM DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain M66-2) GN=mutS PE=3 SV=1 167 1070 1.0E-74
sp|Q9KUI6|MUTS_VIBCH DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mutS PE=3 SV=1 167 1070 1.0E-74
sp|A5F9C4|MUTS_VIBC3 DNA mismatch repair protein MutS OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mutS PE=3 SV=1 167 1070 1.0E-74
sp|Q7V9M5|MUTS_PROMA DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mutS PE=3 SV=1 135 1035 1.0E-74
sp|Q1H2P1|MUTS_METFK DNA mismatch repair protein MutS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mutS1 PE=3 SV=1 176 1043 1.0E-74
sp|A8I275|MUTS_AZOC5 DNA mismatch repair protein MutS OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutS PE=3 SV=1 159 1043 1.0E-74
sp|A3N2Q0|MUTS_ACTP2 DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mutS PE=3 SV=1 173 1043 1.0E-74
sp|Q9HSM2|MUTS1_HALSA DNA mismatch repair protein MutS 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutS1 PE=3 SV=1 181 1035 2.0E-74
sp|B0R2T0|MUTS1_HALS3 DNA mismatch repair protein MutS 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mutS1 PE=3 SV=1 181 1035 2.0E-74
sp|Q3IUH3|MUTS_NATPD DNA mismatch repair protein MutS OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mutS PE=3 SV=1 153 1035 2.0E-74
sp|B3H2J9|MUTS_ACTP7 DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=mutS PE=3 SV=1 173 1043 2.0E-74
sp|Q4QML2|MUTS_HAEI8 DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain 86-028NP) GN=mutS PE=3 SV=1 176 1043 2.0E-74
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 170 1070 3.0E-74
sp|A4G717|MUTS_HERAR DNA mismatch repair protein MutS OS=Herminiimonas arsenicoxydans GN=mutS PE=3 SV=3 169 1043 3.0E-74
sp|Q0IE05|MUTS_SYNS3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9311) GN=mutS PE=3 SV=1 142 1035 5.0E-74
sp|A5I2S2|MUTS_CLOBH DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mutS PE=3 SV=1 484 1054 5.0E-74
sp|A7FUL0|MUTS_CLOB1 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutS PE=3 SV=1 484 1054 5.0E-74
sp|Q21CE8|MUTS_RHOPB DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB18) GN=mutS PE=3 SV=2 173 1043 6.0E-74
sp|Q47WN0|MUTS_COLP3 DNA mismatch repair protein MutS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutS PE=3 SV=1 176 1043 6.0E-74
sp|Q03R33|MUTS_LACBA DNA mismatch repair protein MutS OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutS PE=3 SV=1 176 1043 6.0E-74
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 173 1060 6.0E-74
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 173 1060 7.0E-74
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 173 1060 7.0E-74
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 173 1060 8.0E-74
sp|Q3BVY0|MUTS_XANC5 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutS PE=3 SV=1 164 1043 8.0E-74
sp|B3QPY5|MUTS_CHLP8 DNA mismatch repair protein MutS OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutS PE=3 SV=1 176 1043 9.0E-74
sp|Q317Z7|MUTS_PROM9 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9312) GN=mutS PE=3 SV=1 168 1035 9.0E-74
sp|A5GHU5|MUTS_SYNPW DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH7803) GN=mutS PE=3 SV=1 146 1035 1.0E-73
sp|C3KX35|MUTS_CLOB6 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutS PE=3 SV=1 484 1035 1.0E-73
sp|B5XV49|MUTS_KLEP3 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae (strain 342) GN=mutS PE=3 SV=1 176 1043 1.0E-73
sp|Q8DWW1|MUTS_STRA5 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mutS PE=3 SV=1 479 1045 1.0E-73
sp|Q8E2R3|MUTS_STRA3 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mutS PE=3 SV=1 479 1045 1.0E-73
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 175 1035 1.0E-73
sp|B7LXE0|MUTS_ECO8A DNA mismatch repair protein MutS OS=Escherichia coli O8 (strain IAI1) GN=mutS PE=3 SV=1 176 1043 1.0E-73
sp|B5Z397|MUTS_ECO5E DNA mismatch repair protein MutS OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mutS PE=3 SV=1 176 1043 1.0E-73
sp|Q9S6P8|MUTS_ECO57 DNA mismatch repair protein MutS OS=Escherichia coli O157:H7 GN=mutS PE=3 SV=1 176 1043 1.0E-73
sp|Q3JYM3|MUTS_STRA1 DNA mismatch repair protein MutS OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mutS PE=3 SV=1 479 1045 1.0E-73
sp|C6DZZ3|MUTS_GEOSM DNA mismatch repair protein MutS OS=Geobacter sp. (strain M21) GN=mutS PE=3 SV=1 173 1043 2.0E-73
sp|B0UWV7|MUTS_HISS2 DNA mismatch repair protein MutS OS=Histophilus somni (strain 2336) GN=mutS PE=3 SV=1 176 1043 2.0E-73
sp|Q3YYC9|MUTS_SHISS DNA mismatch repair protein MutS OS=Shigella sonnei (strain Ss046) GN=mutS PE=3 SV=1 176 1043 2.0E-73
sp|B7LEE7|MUTS_ECO55 DNA mismatch repair protein MutS OS=Escherichia coli (strain 55989 / EAEC) GN=mutS PE=3 SV=1 176 1043 2.0E-73
sp|B1IM68|MUTS_CLOBK DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Okra / Type B1) GN=mutS PE=3 SV=1 484 1035 2.0E-73
sp|A7ZQH3|MUTS_ECO24 DNA mismatch repair protein MutS OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mutS PE=3 SV=2 176 1043 2.0E-73
sp|Q8FEL3|MUTS_ECOL6 DNA mismatch repair protein MutS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mutS PE=3 SV=1 176 1043 2.0E-73
sp|Q0TEC9|MUTS_ECOL5 DNA mismatch repair protein MutS OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mutS PE=3 SV=1 176 1043 2.0E-73
sp|B7UHE9|MUTS_ECO27 DNA mismatch repair protein MutS OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|Q83QE9|MUTS_SHIFL DNA mismatch repair protein MutS OS=Shigella flexneri GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|Q0T1G0|MUTS_SHIF8 DNA mismatch repair protein MutS OS=Shigella flexneri serotype 5b (strain 8401) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|Q1R7W4|MUTS_ECOUT DNA mismatch repair protein MutS OS=Escherichia coli (strain UTI89 / UPEC) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|A1AES5|MUTS_ECOK1 DNA mismatch repair protein MutS OS=Escherichia coli O1:K1 / APEC GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|B7MKK5|MUTS_ECO45 DNA mismatch repair protein MutS OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 450 1035 3.0E-73
sp|B7MYN6|MUTS_ECO81 DNA mismatch repair protein MutS OS=Escherichia coli O81 (strain ED1a) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|B7NT79|MUTS_ECO7I DNA mismatch repair protein MutS OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|A6TD24|MUTS_KLEP7 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 494 1043 3.0E-73
sp|A4W4J7|MUTS_STRS2 DNA mismatch repair protein MutS OS=Streptococcus suis (strain 98HAH33) GN=mutS PE=3 SV=1 470 1032 3.0E-73
sp|Q3KH79|MUTS_PSEPF DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutS PE=3 SV=1 176 1043 3.0E-73
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 484 1054 4.0E-73
sp|A4WDU5|MUTS_ENT38 DNA mismatch repair protein MutS OS=Enterobacter sp. (strain 638) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|B3EEE1|MUTS_CHLL2 DNA mismatch repair protein MutS OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 484 1054 4.0E-73
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 173 1035 4.0E-73
sp|B1LQ55|MUTS_ECOSM DNA mismatch repair protein MutS OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|P23909|MUTS_ECOLI DNA mismatch repair protein MutS OS=Escherichia coli (strain K12) GN=mutS PE=1 SV=1 176 1043 4.0E-73
sp|B1IUU6|MUTS_ECOLC DNA mismatch repair protein MutS OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|A8A3L2|MUTS_ECOHS DNA mismatch repair protein MutS OS=Escherichia coli O9:H4 (strain HS) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|B1XCR0|MUTS_ECODH DNA mismatch repair protein MutS OS=Escherichia coli (strain K12 / DH10B) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|C4ZZN7|MUTS_ECOBW DNA mismatch repair protein MutS OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mutS PE=3 SV=1 176 1043 4.0E-73
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 176 1035 4.0E-73
sp|A4YKQ0|MUTS_BRASO DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain ORS278) GN=mutS PE=3 SV=1 157 1043 5.0E-73
sp|B7LWH8|MUTS_ESCF3 DNA mismatch repair protein MutS OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mutS PE=3 SV=1 176 1043 6.0E-73
sp|B7N6W4|MUTS_ECOLU DNA mismatch repair protein MutS OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mutS PE=3 SV=1 176 1043 6.0E-73
sp|A6SXI2|MUTS_JANMA DNA mismatch repair protein MutS OS=Janthinobacterium sp. (strain Marseille) GN=mutS PE=3 SV=1 174 1043 7.0E-73
sp|Q5L7B7|MUTS_BACFN DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutS PE=3 SV=1 174 1053 7.0E-73
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 173 1060 8.0E-73
sp|Q2SBR5|MUTS_HAHCH DNA mismatch repair protein MutS OS=Hahella chejuensis (strain KCTC 2396) GN=mutS PE=3 SV=2 176 1043 8.0E-73
sp|B2S2S5|MUTS_TREPS DNA mismatch repair protein MutS OS=Treponema pallidum subsp. pallidum (strain SS14) GN=mutS PE=3 SV=1 176 1032 8.0E-73
sp|O83348|MUTS_TREPA DNA mismatch repair protein MutS OS=Treponema pallidum (strain Nichols) GN=mutS PE=3 SV=1 176 1032 8.0E-73
sp|B6ENH6|MUTS_ALISL DNA mismatch repair protein MutS OS=Aliivibrio salmonicida (strain LFI1238) GN=mutS PE=3 SV=1 174 1043 8.0E-73
sp|A7MJ43|MUTS_CROS8 DNA mismatch repair protein MutS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutS PE=3 SV=1 176 1043 9.0E-73
sp|A2C5T5|MUTS_PROM3 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9303) GN=mutS PE=3 SV=1 145 1045 9.0E-73
sp|P61672|MUTS_TREDE DNA mismatch repair protein MutS OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=mutS PE=3 SV=1 176 1032 9.0E-73
sp|B6I6B9|MUTS_ECOSE DNA mismatch repair protein MutS OS=Escherichia coli (strain SE11) GN=mutS PE=3 SV=1 176 1043 1.0E-72
sp|Q2NVL9|MUTS_SODGM DNA mismatch repair protein MutS OS=Sodalis glossinidius (strain morsitans) GN=mutS PE=3 SV=1 176 1043 1.0E-72
sp|A6GWN3|MUTS_FLAPJ DNA mismatch repair protein MutS OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutS PE=3 SV=1 171 1053 1.0E-72
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 176 1035 1.0E-72
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 485 1050 1.0E-72
sp|Q7UZL6|MUTS_PROMP DNA mismatch repair protein MutS OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=mutS PE=3 SV=1 168 1035 2.0E-72
sp|Q87XW6|MUTS_PSESM DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutS PE=3 SV=1 176 1043 2.0E-72
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 175 1035 2.0E-72
sp|P44834|MUTS_HAEIN DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutS PE=3 SV=1 176 1043 2.0E-72
sp|B2VG22|MUTS_ERWT9 DNA mismatch repair protein MutS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutS PE=3 SV=1 169 1043 2.0E-72
sp|Q07V29|MUTS_RHOP5 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisA53) GN=mutS PE=3 SV=1 160 1047 2.0E-72
sp|Q4KHE3|MUTS_PSEF5 DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mutS PE=3 SV=1 176 1043 2.0E-72
sp|Q3ANH5|MUTS_SYNSC DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9605) GN=mutS PE=3 SV=1 144 1035 3.0E-72
sp|Q7VKA1|MUTS_HAEDU DNA mismatch repair protein MutS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutS PE=3 SV=1 169 1043 3.0E-72
sp|B7VK59|MUTS_VIBTL DNA mismatch repair protein MutS OS=Vibrio tasmaniensis (strain LGP32) GN=mutS PE=3 SV=1 174 1043 3.0E-72
sp|B2G6E5|MUTS_LACRJ DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain JCM 1112) GN=mutS PE=3 SV=1 174 1043 3.0E-72
sp|A5VIW9|MUTS_LACRD DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain DSM 20016) GN=mutS PE=3 SV=1 174 1043 3.0E-72
sp|A5ETJ3|MUTS_BRASB DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutS PE=3 SV=1 158 1043 3.0E-72
sp|Q0I1B8|MUTS_HAES1 DNA mismatch repair protein MutS OS=Haemophilus somnus (strain 129Pt) GN=mutS PE=3 SV=1 176 1043 3.0E-72
sp|B5FAC8|MUTS_VIBFM DNA mismatch repair protein MutS OS=Vibrio fischeri (strain MJ11) GN=mutS PE=3 SV=1 174 1043 4.0E-72
sp|A5EX62|MUTS_DICNV DNA mismatch repair protein MutS OS=Dichelobacter nodosus (strain VCS1703A) GN=mutS PE=3 SV=1 169 1043 4.0E-72
sp|Q32CJ6|MUTS_SHIDS DNA mismatch repair protein MutS OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mutS PE=3 SV=1 176 1043 4.0E-72
sp|A6W1Q6|MUTS_MARMS DNA mismatch repair protein MutS OS=Marinomonas sp. (strain MWYL1) GN=mutS PE=3 SV=1 176 1044 4.0E-72
sp|Q65QA9|MUTS_MANSM DNA mismatch repair protein MutS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutS PE=3 SV=1 176 1043 5.0E-72
sp|B2J434|MUTS_NOSP7 DNA mismatch repair protein MutS OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutS PE=3 SV=1 173 1043 5.0E-72
sp|B1KSA3|MUTS_CLOBM DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutS PE=3 SV=1 484 1035 5.0E-72
sp|A1AMW9|MUTS_PELPD DNA mismatch repair protein MutS OS=Pelobacter propionicus (strain DSM 2379) GN=mutS PE=3 SV=1 176 1035 5.0E-72
sp|A2BTM6|MUTS_PROMS DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain AS9601) GN=mutS PE=3 SV=1 168 1043 6.0E-72
sp|Q6MBV4|MUTS_PARUW DNA mismatch repair protein MutS OS=Protochlamydia amoebophila (strain UWE25) GN=mutS PE=3 SV=1 173 1063 6.0E-72
sp|Q4ZWP5|MUTS_PSEU2 DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mutS PE=3 SV=1 176 1043 6.0E-72
sp|Q31X95|MUTS_SHIBS DNA mismatch repair protein MutS OS=Shigella boydii serotype 4 (strain Sb227) GN=mutS PE=3 SV=1 176 1043 7.0E-72
sp|B2TZJ7|MUTS_SHIB3 DNA mismatch repair protein MutS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutS PE=3 SV=1 176 1043 7.0E-72
sp|A5W816|MUTS_PSEP1 DNA mismatch repair protein MutS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mutS PE=3 SV=1 176 1043 7.0E-72
sp|Q7N8K0|MUTS_PHOLL DNA mismatch repair protein MutS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutS PE=3 SV=1 176 1043 7.0E-72
sp|Q7MHR2|MUTS_VIBVY DNA mismatch repair protein MutS OS=Vibrio vulnificus (strain YJ016) GN=mutS PE=3 SV=2 176 1044 9.0E-72
sp|P61667|MUTS_GEOSL DNA mismatch repair protein MutS OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutS PE=3 SV=1 173 1035 9.0E-72
sp|Q88ME7|MUTS_PSEPK DNA mismatch repair protein MutS OS=Pseudomonas putida (strain KT2440) GN=mutS PE=3 SV=1 176 1043 9.0E-72
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 446 1043 1.0E-71
sp|A3PFD3|MUTS_PROM0 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9301) GN=mutS PE=3 SV=1 168 1043 1.0E-71
sp|B1JB25|MUTS_PSEPW DNA mismatch repair protein MutS OS=Pseudomonas putida (strain W619) GN=mutS PE=3 SV=1 176 1043 2.0E-71
sp|Q8DC53|MUTS_VIBVU DNA mismatch repair protein MutS OS=Vibrio vulnificus (strain CMCP6) GN=mutS PE=3 SV=2 176 1044 2.0E-71
sp|Q4L5Z9|MUTS_STAHJ DNA mismatch repair protein MutS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mutS PE=3 SV=1 176 1035 2.0E-71
sp|Q5E7G7|MUTS_VIBF1 DNA mismatch repair protein MutS OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutS PE=3 SV=2 174 1043 2.0E-71
sp|C3KCT2|MUTS_PSEFS DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain SBW25) GN=mutS PE=3 SV=1 176 1043 2.0E-71
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 175 1043 3.0E-71
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 176 1043 3.0E-71
sp|B0KSD2|MUTS_PSEPG DNA mismatch repair protein MutS OS=Pseudomonas putida (strain GB-1) GN=mutS PE=3 SV=2 176 1043 4.0E-71
sp|Q4US90|MUTS_XANC8 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutS PE=3 SV=2 487 1043 4.0E-71
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 167 1043 4.0E-71
sp|A0LXZ7|MUTS_GRAFK DNA mismatch repair protein MutS OS=Gramella forsetii (strain KT0803) GN=mutS PE=3 SV=1 171 1043 4.0E-71
sp|B3W9W4|MUTS_LACCB DNA mismatch repair protein MutS OS=Lactobacillus casei (strain BL23) GN=mutS PE=3 SV=1 176 1045 5.0E-71
sp|Q48F92|MUTS_PSE14 DNA mismatch repair protein MutS OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mutS PE=3 SV=1 176 1043 5.0E-71
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 167 1043 5.0E-71
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 167 1043 5.0E-71
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 167 1043 5.0E-71
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 172 1035 5.0E-71
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 173 1043 6.0E-71
sp|Q1C471|MUTS_YERPA DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutS PE=3 SV=1 167 1043 6.0E-71
sp|Q8PBB5|MUTS_XANCP DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutS PE=3 SV=1 487 1043 7.0E-71
sp|B8CJQ5|MUTS_SHEPW DNA mismatch repair protein MutS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutS PE=3 SV=1 174 1043 7.0E-71
sp|Q3AQZ8|MUTS_CHLCH DNA mismatch repair protein MutS OS=Chlorobium chlorochromatii (strain CaD3) GN=mutS PE=3 SV=1 471 1043 7.0E-71
sp|A4TQ04|MUTS_YERPP DNA mismatch repair protein MutS OS=Yersinia pestis (strain Pestoides F) GN=mutS PE=3 SV=1 167 1043 7.0E-71
sp|Q1CLQ9|MUTS_YERPN DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutS PE=3 SV=1 167 1043 7.0E-71
sp|A9R111|MUTS_YERPG DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutS PE=3 SV=1 167 1043 7.0E-71
sp|Q8ZBQ3|MUTS_YERPE DNA mismatch repair protein MutS OS=Yersinia pestis GN=mutS PE=3 SV=1 167 1043 7.0E-71
sp|B8DFS4|MUTS_LISMH DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutS PE=3 SV=1 176 1048 7.0E-71
sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 494 1043 7.0E-71
sp|B0JFY0|MUTS_MICAN DNA mismatch repair protein MutS OS=Microcystis aeruginosa (strain NIES-843) GN=mutS PE=3 SV=1 158 1043 8.0E-71
sp|A4IMI0|MUTS_GEOTN DNA mismatch repair protein MutS OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutS PE=3 SV=1 176 1043 8.0E-71
sp|Q64MG7|MUTS_BACFR DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain YCH46) GN=mutS PE=3 SV=1 178 1053 8.0E-71
sp|Q035Z2|MUTS_LACC3 DNA mismatch repair protein MutS OS=Lactobacillus casei (strain ATCC 334) GN=mutS PE=3 SV=1 176 1045 8.0E-71
sp|A6LG92|MUTS_PARD8 DNA mismatch repair protein MutS OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutS PE=3 SV=1 176 1053 9.0E-71
sp|Q82U08|MUTS_NITEU DNA mismatch repair protein MutS OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutS PE=3 SV=1 168 1049 1.0E-70
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 176 1043 1.0E-70
sp|Q87LQ9|MUTS_VIBPA DNA mismatch repair protein MutS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutS PE=3 SV=1 174 1043 1.0E-70
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 173 1043 2.0E-70
sp|Q71ZR7|MUTS_LISMF DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutS PE=3 SV=1 176 1048 2.0E-70
sp|Q49X88|MUTS_STAS1 DNA mismatch repair protein MutS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutS PE=3 SV=1 176 1033 2.0E-70
sp|Q6D8C1|MUTS_PECAS DNA mismatch repair protein MutS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutS PE=3 SV=1 176 1043 2.0E-70
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 175 1035 3.0E-70
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 175 1035 3.0E-70
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 171 1043 3.0E-70
sp|Q8Y789|MUTS_LISMO DNA mismatch repair protein MutS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutS PE=3 SV=1 176 1048 4.0E-70
sp|Q30ZX3|MUTS_DESAG DNA mismatch repair protein MutS OS=Desulfovibrio alaskensis (strain G20) GN=mutS PE=3 SV=1 174 1035 4.0E-70
sp|A1JJU1|MUTS_YERE8 DNA mismatch repair protein MutS OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mutS PE=3 SV=1 176 1043 5.0E-70
sp|C1L2V9|MUTS_LISMC DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutS PE=3 SV=1 176 1048 6.0E-70
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 173 1043 7.0E-70
sp|Q92BV3|MUTS_LISIN DNA mismatch repair protein MutS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutS PE=3 SV=1 176 1043 7.0E-70
sp|Q5H2C5|MUTS_XANOR DNA mismatch repair protein MutS OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutS PE=3 SV=1 487 1043 9.0E-70
sp|Q7VY01|MUTS_BORPE DNA mismatch repair protein MutS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutS PE=3 SV=1 176 1043 1.0E-69
sp|A9MF43|MUTS_SALAR DNA mismatch repair protein MutS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutS PE=3 SV=1 453 1043 1.0E-69
sp|A0AIK5|MUTS_LISW6 DNA mismatch repair protein MutS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutS PE=3 SV=1 176 1043 1.0E-69
sp|C0PWV2|MUTS_SALPC DNA mismatch repair protein MutS OS=Salmonella paratyphi C (strain RKS4594) GN=mutS PE=3 SV=1 453 1043 1.0E-69
sp|A7MTT8|MUTS_VIBCB DNA mismatch repair protein MutS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mutS PE=3 SV=1 174 1043 1.0E-69
sp|Q5PEE6|MUTS_SALPA DNA mismatch repair protein MutS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|Q1I659|MUTS_PSEE4 DNA mismatch repair protein MutS OS=Pseudomonas entomophila (strain L48) GN=mutS PE=3 SV=1 176 1043 2.0E-69
sp|Q03EQ7|MUTS_PEDPA DNA mismatch repair protein MutS OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutS PE=3 SV=1 176 1043 2.0E-69
sp|P0A1Y0|MUTS_SALTY DNA mismatch repair protein MutS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutS PE=1 SV=1 453 1043 2.0E-69
sp|P0A1Y1|MUTS_SALTI DNA mismatch repair protein MutS OS=Salmonella typhi GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|A9N1F8|MUTS_SALPB DNA mismatch repair protein MutS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutS PE=3 SV=2 453 1043 2.0E-69
sp|B4TFU6|MUTS_SALHS DNA mismatch repair protein MutS OS=Salmonella heidelberg (strain SL476) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|B5RDN2|MUTS_SALG2 DNA mismatch repair protein MutS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|Q57KL5|MUTS_SALCH DNA mismatch repair protein MutS OS=Salmonella choleraesuis (strain SC-B67) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|B5F3Y8|MUTS_SALA4 DNA mismatch repair protein MutS OS=Salmonella agona (strain SL483) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|B5FTQ5|MUTS_SALDC DNA mismatch repair protein MutS OS=Salmonella dublin (strain CT_02021853) GN=mutS PE=3 SV=1 453 1043 2.0E-69
sp|Q2GJL7|MUTS_ANAPZ DNA mismatch repair protein MutS OS=Anaplasma phagocytophilum (strain HZ) GN=mutS PE=3 SV=1 176 1035 3.0E-69
sp|C0R5H4|MUTS_WOLWR DNA mismatch repair protein MutS OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutS PE=3 SV=1 174 1043 3.0E-69
sp|P57972|MUTS_PASMU DNA mismatch repair protein MutS OS=Pasteurella multocida (strain Pm70) GN=mutS PE=3 SV=1 176 1043 5.0E-69
sp|A0B976|MUTS_METTP DNA mismatch repair protein MutS OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutS PE=3 SV=1 173 1046 5.0E-69
sp|Q3SJP0|MUTS_THIDA DNA mismatch repair protein MutS OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutS PE=3 SV=1 172 1043 5.0E-69
sp|A6VL76|MUTS_ACTSZ DNA mismatch repair protein MutS OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutS PE=3 SV=1 176 1043 5.0E-69
sp|B0BRS8|MUTS_ACTPJ DNA mismatch repair protein MutS OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mutS PE=3 SV=1 485 1043 6.0E-69
sp|Q8KCC0|MUTS_CHLTE DNA mismatch repair protein MutS OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutS PE=3 SV=1 491 1051 7.0E-69
sp|B4TTU0|MUTS_SALSV DNA mismatch repair protein MutS OS=Salmonella schwarzengrund (strain CVM19633) GN=mutS PE=3 SV=1 453 1043 7.0E-69
sp|B2KB17|MUTS_ELUMP DNA mismatch repair protein MutS OS=Elusimicrobium minutum (strain Pei191) GN=mutS PE=3 SV=1 174 1043 8.0E-69
sp|B4T436|MUTS_SALNS DNA mismatch repair protein MutS OS=Salmonella newport (strain SL254) GN=mutS PE=3 SV=1 453 1043 9.0E-69
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 173 1028 1.0E-68
sp|P74926|MUTS_THEMA DNA mismatch repair protein MutS OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mutS PE=3 SV=2 482 1035 1.0E-68
sp|Q5L0E5|MUTS_GEOKA DNA mismatch repair protein MutS OS=Geobacillus kaustophilus (strain HTA426) GN=mutS PE=3 SV=1 181 1043 1.0E-68
sp|Q2YB94|MUTS_NITMU DNA mismatch repair protein MutS OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mutS PE=3 SV=1 176 1053 2.0E-68
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 178 1035 3.0E-68
sp|Q7NRW7|MUTS_CHRVO DNA mismatch repair protein MutS OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mutS PE=3 SV=1 176 1043 3.0E-68
sp|Q8A334|MUTS_BACTN DNA mismatch repair protein MutS OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutS PE=3 SV=1 178 1053 3.0E-68
sp|A8FST7|MUTS_SHESH DNA mismatch repair protein MutS OS=Shewanella sediminis (strain HAW-EB3) GN=mutS PE=3 SV=1 174 1043 3.0E-68
sp|Q8DGS4|MUTS_THEEB DNA mismatch repair protein MutS OS=Thermosynechococcus elongatus (strain BP-1) GN=mutS PE=3 SV=1 175 1043 3.0E-68
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 176 1043 4.0E-68
sp|Q2J2S1|MUTS_RHOP2 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain HaA2) GN=mutS PE=3 SV=1 174 1047 5.0E-68
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 176 1043 5.0E-68
sp|Q63SR9|MUTS_BURPS DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain K96243) GN=mutS PE=3 SV=1 176 1043 6.0E-68
sp|Q1QQJ4|MUTS_NITHX DNA mismatch repair protein MutS OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutS PE=3 SV=1 158 1043 6.0E-68
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 176 1043 6.0E-68
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 176 1043 6.0E-68
sp|Q127P5|MUTS_POLSJ DNA mismatch repair protein MutS OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mutS PE=3 SV=1 172 1032 6.0E-68
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 176 1043 7.0E-68
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 176 1043 7.0E-68
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 176 1043 7.0E-68
sp|A7Z4X5|MUTS_BACMF DNA mismatch repair protein MutS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutS PE=3 SV=1 173 1043 7.0E-68
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 176 1043 7.0E-68
sp|Q9VUM0|MSH6_DROME Probable DNA mismatch repair protein Msh6 OS=Drosophila melanogaster GN=Msh6 PE=1 SV=2 482 1051 8.0E-68
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 176 1043 8.0E-68
sp|Q3JQS6|MUTS_BURP1 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1710b) GN=mutS PE=3 SV=2 176 1043 1.0E-67
sp|Q8CXG6|MUTS_OCEIH DNA mismatch repair protein MutS OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutS PE=3 SV=1 370 1049 1.0E-67
sp|A1V5I2|MUTS_BURMS DNA mismatch repair protein MutS OS=Burkholderia mallei (strain SAVP1) GN=mutS PE=3 SV=2 176 1043 2.0E-67
sp|Q62J26|MUTS_BURMA DNA mismatch repair protein MutS OS=Burkholderia mallei (strain ATCC 23344) GN=mutS PE=3 SV=1 176 1043 2.0E-67
sp|A2SAW7|MUTS_BURM9 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10229) GN=mutS PE=3 SV=2 176 1043 2.0E-67
sp|A3ML57|MUTS_BURM7 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10247) GN=mutS PE=3 SV=2 176 1043 2.0E-67
sp|B9K800|MUTS_THENN DNA mismatch repair protein MutS OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutS PE=3 SV=1 444 1032 2.0E-67
sp|Q9ZIX6|MUTS_THECA DNA mismatch repair protein MutS OS=Thermus caldophilus GN=mutS PE=3 SV=1 168 1075 2.0E-67
sp|B0CIQ5|MUTS_BRUSI DNA mismatch repair protein MutS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutS PE=3 SV=1 172 1035 2.0E-67
sp|B0TX99|MUTS_FRAP2 DNA mismatch repair protein MutS OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mutS PE=3 SV=1 176 1043 2.0E-67
sp|Q8YES6|MUTS_BRUME DNA mismatch repair protein MutS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutS PE=3 SV=2 172 1035 2.0E-67
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 485 1043 2.0E-67
sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutS PE=3 SV=1 175 1033 2.0E-67
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 175 1035 2.0E-67
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 176 1043 2.0E-67
sp|Q8G310|MUTS_BRUSU DNA mismatch repair protein MutS OS=Brucella suis biovar 1 (strain 1330) GN=mutS PE=3 SV=1 172 1035 2.0E-67
sp|A9M792|MUTS_BRUC2 DNA mismatch repair protein MutS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutS PE=3 SV=1 172 1035 2.0E-67
sp|A5VN83|MUTS_BRUO2 DNA mismatch repair protein MutS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutS PE=3 SV=1 172 1035 2.0E-67
sp|Q01X96|MUTS_SOLUE DNA mismatch repair protein MutS OS=Solibacter usitatus (strain Ellin6076) GN=mutS PE=3 SV=1 176 1035 3.0E-67
sp|A8EZG1|MUTS_RICCK DNA mismatch repair protein MutS OS=Rickettsia canadensis (strain McKiel) GN=mutS PE=3 SV=1 176 1035 3.0E-67
sp|Q57FM9|MUTS_BRUAB DNA mismatch repair protein MutS OS=Brucella abortus biovar 1 (strain 9-941) GN=mutS PE=3 SV=1 172 1035 4.0E-67
sp|Q2YNZ0|MUTS_BRUA2 DNA mismatch repair protein MutS OS=Brucella abortus (strain 2308) GN=mutS PE=3 SV=1 172 1035 4.0E-67
sp|C0QFS1|MUTS_DESAH DNA mismatch repair protein MutS OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=mutS PE=3 SV=1 174 1043 4.0E-67
sp|Q03VV4|MUTS_LEUMM DNA mismatch repair protein MutS OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=mutS PE=3 SV=1 450 1043 4.0E-67
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 176 1043 4.0E-67
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 176 1043 4.0E-67
sp|A3NWZ4|MUTS_BURP0 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1106a) GN=mutS PE=3 SV=2 176 1043 5.0E-67
sp|Q5NL79|MUTS_ZYMMO DNA mismatch repair protein MutS OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mutS PE=3 SV=2 178 1043 5.0E-67
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 176 1043 7.0E-67
sp|Q38YR4|MUTS_LACSS DNA mismatch repair protein MutS OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mutS PE=3 SV=1 171 1043 7.0E-67
sp|Q21XE3|MUTS_RHOFT DNA mismatch repair protein MutS OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mutS PE=3 SV=1 164 1043 8.0E-67
sp|P61670|MUTS_RHOPA DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutS PE=3 SV=1 174 1047 9.0E-67
sp|Q87CI8|MUTS_XYLFT DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutS PE=3 SV=1 485 1043 9.0E-67
sp|Q55GU9|MSH6_DICDI DNA mismatch repair protein Msh6 OS=Dictyostelium discoideum GN=msh6 PE=3 SV=1 671 1080 1.0E-66
sp|A1WXK9|MUTS_HALHL DNA mismatch repair protein MutS OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mutS PE=3 SV=1 176 1043 1.0E-66
sp|Q88UZ7|MUTS_LACPL DNA mismatch repair protein MutS OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutS PE=3 SV=1 494 1043 1.0E-66
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 174 1043 1.0E-66
sp|A3NB64|MUTS_BURP6 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 668) GN=mutS PE=3 SV=1 176 1043 1.0E-66
sp|Q1WT15|MUTS_LACS1 DNA mismatch repair protein MutS OS=Lactobacillus salivarius (strain UCC118) GN=mutS PE=3 SV=1 171 1043 2.0E-66
sp|Q1MRT4|MUTS_LAWIP DNA mismatch repair protein MutS OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mutS PE=3 SV=1 169 1043 2.0E-66
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 173 1043 2.0E-66
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 176 1043 2.0E-66
sp|Q10YG4|MUTS_TRIEI DNA mismatch repair protein MutS OS=Trichodesmium erythraeum (strain IMS101) GN=mutS PE=3 SV=1 150 1032 2.0E-66
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 176 1043 2.0E-66
sp|B8FJL5|MUTS_DESAA DNA mismatch repair protein MutS OS=Desulfatibacillum alkenivorans (strain AK-01) GN=mutS PE=3 SV=1 174 1032 2.0E-66
sp|P61673|MUTS_WOLPM DNA mismatch repair protein MutS OS=Wolbachia pipientis wMel GN=mutS PE=3 SV=1 174 1043 3.0E-66
sp|C6DAK6|MUTS_PECCP DNA mismatch repair protein MutS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutS PE=3 SV=1 453 1044 3.0E-66
sp|B3EP11|MUTS_CHLPB DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain BS1) GN=mutS PE=3 SV=1 176 1035 3.0E-66
sp|Q46IE5|MUTS_PROMT DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain NATL2A) GN=mutS PE=3 SV=1 175 1043 3.0E-66
sp|A1BHN5|MUTS_CHLPD DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutS PE=3 SV=1 471 1078 3.0E-66
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 176 1043 4.0E-66
sp|Q2SXA6|MUTS_BURTA DNA mismatch repair protein MutS OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mutS PE=3 SV=1 176 1043 5.0E-66
sp|A1UU95|MUTS_BARBK DNA mismatch repair protein MutS OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutS PE=3 SV=1 174 1043 5.0E-66
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 176 1043 6.0E-66
sp|A4SFT1|MUTS_CHLPM DNA mismatch repair protein MutS OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutS PE=3 SV=1 491 1043 8.0E-66
sp|Q3YSJ8|MUTS_EHRCJ DNA mismatch repair protein MutS OS=Ehrlichia canis (strain Jake) GN=mutS PE=3 SV=1 174 1035 9.0E-66
sp|Q5QUB6|MUTS_IDILO DNA mismatch repair protein MutS OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutS PE=3 SV=2 448 1043 9.0E-66
sp|Q2KWZ4|MUTS_BORA1 DNA mismatch repair protein MutS OS=Bordetella avium (strain 197N) GN=mutS PE=3 SV=1 176 1043 1.0E-65
sp|Q13ED0|MUTS_RHOPS DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB5) GN=mutS PE=3 SV=1 159 1047 2.0E-65
sp|A8GX86|MUTS_RICB8 DNA mismatch repair protein MutS OS=Rickettsia bellii (strain OSU 85-389) GN=mutS PE=3 SV=1 176 1035 3.0E-65
sp|B1YMD7|MUTS_EXIS2 DNA mismatch repair protein MutS OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutS PE=3 SV=1 491 1043 3.0E-65
sp|Q7MXR7|MUTS_PORGI DNA mismatch repair protein MutS OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mutS PE=3 SV=1 170 1035 3.0E-65
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 174 1043 3.0E-65
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 158 1043 4.0E-65
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 174 1043 4.0E-65
sp|Q89AD3|MUTS_BUCBP DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutS PE=3 SV=1 176 1042 4.0E-65
sp|C4K6P7|MUTS_HAMD5 DNA mismatch repair protein MutS OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=mutS PE=3 SV=1 176 1035 4.0E-65
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 176 1043 6.0E-65
sp|Q1RJJ5|MUTS_RICBR DNA mismatch repair protein MutS OS=Rickettsia bellii (strain RML369-C) GN=mutS PE=3 SV=1 176 1035 7.0E-65
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 181 1043 8.0E-65
sp|A7GR99|MUTS_BACCN DNA mismatch repair protein MutS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutS PE=3 SV=1 479 1043 8.0E-65
sp|Q9HSL6|MUTS2_HALSA DNA mismatch repair protein MutS 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mutS2 PE=3 SV=1 170 1035 1.0E-64
sp|Q55GU9|MSH6_DICDI DNA mismatch repair protein Msh6 OS=Dictyostelium discoideum GN=msh6 PE=3 SV=1 173 600 1.0E-30
sp|C3KX35|MUTS_CLOB6 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutS PE=3 SV=1 175 302 6.0E-09
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 175 302 6.0E-09
sp|A5I2S2|MUTS_CLOBH DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mutS PE=3 SV=1 175 302 8.0E-09
sp|A7FUL0|MUTS_CLOB1 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutS PE=3 SV=1 175 302 8.0E-09
sp|B1IM68|MUTS_CLOBK DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Okra / Type B1) GN=mutS PE=3 SV=1 175 302 9.0E-09
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 175 302 9.0E-09
sp|B1KSA3|MUTS_CLOBM DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutS PE=3 SV=1 175 302 9.0E-09
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 174 302 1.0E-08
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 175 300 4.0E-08
sp|P74926|MUTS_THEMA DNA mismatch repair protein MutS OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mutS PE=3 SV=2 174 327 1.0E-07
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 176 301 2.0E-07
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 176 330 3.0E-07
sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 176 330 2.0E-06
sp|B9K800|MUTS_THENN DNA mismatch repair protein MutS OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutS PE=3 SV=1 174 270 2.0E-06
sp|Q5QUB6|MUTS_IDILO DNA mismatch repair protein MutS OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutS PE=3 SV=2 176 302 3.0E-06
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 173 301 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030983 mismatched DNA binding Yes
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0050896 response to stimulus No
GO:0003677 DNA binding No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0006950 response to stress No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0003690 double-stranded DNA binding No
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0008150 biological_process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0033554 cellular response to stress No
GO:0006281 DNA repair No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1421
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5458
Ophiocordyceps australis map64 (Brazil) OphauB2|3006
Ophiocordyceps camponoti-floridani Ophcf2|07143
Ophiocordyceps camponoti-rufipedis Ophun1|7108 (this protein)
Ophiocordyceps kimflemingae Ophio5|2705
Ophiocordyceps subramaniannii Hirsu2|1092

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7108
MAPASKPPPQKKQQSLTSFFTPKTVNGLAASFEKQSRSPDAQSRKRPADQDADDADDVPHKPQRTAKKPKTSNED
DETRLPSPATAPPARAQRYLYDASSSAPAPDDATKRVNEDLHRRFVKKLGNPDALTWKGRASLQQAPGGEDEADA
DDDEADEQPPAPAKAGKKNAKPAKLTPMEVQFLDIKRKHMDTVLIVEVGYKFRFFGEDARIAAKELSIVCIPGKL
RYDEHPSEAHLDRFASASIPVHRLSVHARRLVAAGHKVGVVRQIETAALKKAGDNRNAPFVRKLTNLYTKGTYID
ENGELDQQTDGAPSGGYLLAITETKSKGSGTDEKVQVGILAVQPATGDIVYDVFEDGFMRSEVETRLLHISPCEF
LIVGDLTPATNKLIQHLSGSSTNVFGDRSRVERVSRSSTAGAEASSHVAQFYADRLKDGSTDALLSKVLELPEPV
TVCLSAMINHLKEYGLEHIFNLTKYFQDFGTRSHVLINGTTLESLEVYRNSTDHSEKGSLFWALDKTLTRFGQRL
LRKWIGRPLLDRDGLEQRMAAVQELVDKRCHPPVEELENLLSSIKPDLERSLIRIYYGKCTRPELLSVLQTLQKI
ATYYSTSESSSRSPFSSPPLATSVRALPSILNSVITYLDPIDAQAARKDDKYAFFRSQHQTEEMQDHQLAIVHVE
HELETHRSAAASQISKNKVDYVTVAGIEFLIEVPNSDVSHVPASWTKISGTKKLSRFHTPDVVRLIAERDQHREA
LAAACDRAFKNLLATIAADYQPLRDAVSALATLDCLLSLAKVAAQPGYTRPTLLPSSSPPTISISRGRHPMAEHL
IDYIPFTTSLAHPSPLAHLITGPNMGGKSSFVRALALIVLLAQIGSFVPADSLELTLCDAIHTRSGAHDNLLAGE
STFMVELSETARILQAATPRSLVILDELGRGTSTHDGAAIAHAVLHHVVAETRCLTLFITHYQNLARVVDGLEGV
DNVHMRFRAEAAPASEDDDAAGHQDDITFLYEVADGVAHRSYGLNVARLARIPKHVIDVAATKSAELELDVRRRR
LQGACRMLQSVVSGRDPDQLQQLVASIEQL*
Coding >Ophun1|7108
ATGGCTCCCGCTTCGAAACCCCCTCCTCAAAAGAAGCAGCAGTCTCTGACCTCCTTCTTCACGCCAAAGACGGTC
AATGGATTGGCTGCCTCGTTCGAGAAGCAGAGCCGAAGCCCAGATGCCCAGTCTCGCAAGCGTCCGGCCGACCAA
GACGCCGACGATGCCGACGACGTCCCGCACAAGCCTCAACGCACCGCCAAGAAGCCCAAGACTTCTAATGAAGAC
GATGAGACTCGCTTGCCATCGCCCGCCACAGCTCCTCCAGCACGCGCCCAACGCTATCTCTACGATGCCTCCAGC
TCTGCCCCTGCCCCTGACGACGCCACGAAGCGGGTAAACGAAGACCTACACAGGCGATTCGTCAAGAAGCTCGGC
AACCCAGACGCCTTGACTTGGAAAGGCCGCGCTTCTCTTCAGCAAGCACCTGGGGGCGAAGACGAGGCAGACGCC
GACGACGATGAAGCCGACGAGCAGCCTCCGGCTCCCGCCAAGGCCGGCAAGAAGAACGCCAAGCCGGCGAAGCTG
ACTCCCATGGAGGTTCAGTTCCTCGACATCAAGAGAAAGCACATGGACACTGTCCTCATTGTCGAGGTCGGCTAC
AAGTTTCGCTTCTTTGGTGAGGATGCGCGAATCGCGGCCAAGGAGCTCAGCATCGTTTGCATACCCGGCAAGCTG
CGATACGACGAGCATCCGTCCGAGGCGCACCTGGACCGCTTCGCTTCCGCCAGCATTCCCGTCCACCGACTGTCC
GTCCATGCCAGGCGGCTGGTCGCAGCTGGCCACAAGGTCGGCGTCGTCCGCCAGATCGAAACAGCCGCGCTCAAG
AAGGCGGGCGACAACCGGAACGCCCCCTTTGTCCGAAAGCTCACCAACCTCTACACCAAGGGCACCTACATCGAC
GAAAACGGCGAGCTGGATCAGCAGACGGACGGTGCTCCCTCGGGAGGTTACCTGCTGGCCATCACCGAGACCAAA
TCCAAGGGCTCCGGGACGGATGAAAAGGTCCAAGTCGGCATCCTCGCCGTCCAGCCTGCGACGGGCGACATCGTC
TACGACGTCTTCGAGGACGGCTTCATGCGCAGCGAGGTGGAAACGAGACTGCTGCACATATCGCCCTGCGAATTC
CTCATCGTCGGTGACCTCACCCCGGCCACCAACAAGCTAATCCAGCACCTGTCCGGGAGCAGCACCAACGTCTTC
GGCGACCGCAGCCGCGTCGAGCGCGTATCCCGGAGCTCGACCGCCGGCGCCGAAGCCTCATCGCACGTGGCCCAG
TTCTACGCCGACCGACTCAAAGACGGCTCAACCGACGCCCTCCTCAGCAAGGTCCTGGAGCTGCCGGAGCCAGTA
ACCGTCTGCCTCTCAGCCATGATCAACCACCTCAAAGAGTACGGGCTCGAGCACATCTTCAACCTGACCAAGTAC
TTCCAAGACTTCGGCACCCGCTCCCACGTCCTCATCAACGGAACCACGCTCGAAAGCCTCGAAGTCTACCGCAAC
TCAACCGACCACTCAGAAAAGGGCAGCCTCTTCTGGGCCCTCGACAAGACGCTCACTCGCTTCGGCCAACGCCTC
CTCCGCAAATGGATCGGCCGCCCCCTTCTAGACAGAGACGGCCTCGAGCAAAGAATGGCAGCCGTACAGGAACTC
GTCGACAAGCGTTGCCACCCCCCCGTCGAAGAGCTGGAAAACCTACTGTCCTCCATCAAGCCCGATCTCGAACGC
AGCCTCATCCGCATCTACTACGGAAAATGCACCAGACCCGAGCTCCTATCCGTCCTCCAAACCCTCCAGAAGATT
GCGACCTACTACTCAACCTCAGAATCATCCTCAAGATCCCCCTTCTCTTCCCCCCCCCTCGCAACCTCCGTCCGC
GCCCTCCCCTCCATCCTCAACTCGGTGATAACCTACCTCGACCCCATCGACGCCCAAGCAGCCCGCAAAGACGAC
AAATACGCCTTCTTCCGCTCCCAGCACCAAACAGAAGAAATGCAAGACCACCAGCTCGCCATCGTCCACGTCGAG
CACGAACTCGAAACCCATCGCTCCGCCGCCGCCTCGCAAATCTCAAAGAACAAGGTCGACTACGTCACCGTCGCC
GGCATCGAGTTCCTCATCGAAGTCCCAAACTCAGACGTCAGCCACGTCCCCGCCTCGTGGACCAAAATCTCGGGC
ACAAAGAAGCTCTCCCGCTTTCACACCCCAGACGTCGTCCGCCTCATCGCCGAACGAGATCAACACCGCGAAGCC
CTCGCCGCCGCCTGCGACCGCGCCTTCAAGAACCTCCTCGCAACAATAGCTGCAGACTACCAACCCCTCCGCGAC
GCCGTCTCCGCCCTCGCAACCCTAGATTGCCTCCTCTCGCTGGCAAAGGTCGCCGCCCAACCAGGCTACACCCGT
CCGACCCTCCTCCCCTCCTCCAGCCCTCCCACCATCTCCATCTCCCGCGGCCGCCACCCCATGGCCGAGCATCTC
ATCGACTACATCCCCTTCACAACCAGTCTCGCCCACCCCTCCCCCCTAGCCCACCTGATAACCGGCCCCAACATG
GGCGGCAAATCCTCCTTCGTCCGCGCCCTAGCCCTCATCGTCCTCCTCGCCCAGATAGGCTCCTTCGTCCCCGCA
GACTCCCTCGAGCTCACCCTCTGCGACGCAATCCACACCCGCTCAGGAGCCCACGATAACCTCCTGGCCGGCGAG
TCCACCTTCATGGTCGAGCTCTCGGAGACAGCCCGCATCCTCCAAGCCGCTACGCCCCGAAGCCTCGTCATCCTC
GACGAGCTCGGTCGCGGCACCAGCACCCACGACGGCGCCGCCATCGCCCACGCCGTCCTCCATCACGTCGTCGCC
GAGACCCGTTGTCTTACCCTCTTCATCACCCACTATCAGAATCTCGCCCGCGTCGTAGACGGCCTCGAGGGCGTC
GACAATGTCCATATGCGCTTCAGAGCCGAGGCAGCACCCGCGAGCGAAGATGACGACGCCGCCGGTCATCAAGAC
GATATTACTTTCCTCTACGAAGTCGCCGATGGCGTCGCCCATCGATCCTACGGCCTCAACGTCGCCCGCCTCGCC
CGCATCCCCAAGCACGTCATCGACGTTGCCGCCACAAAGTCGGCCGAGCTTGAGCTCGACGTCAGGAGGCGGAGG
CTGCAGGGTGCCTGTCGAATGCTCCAGTCCGTCGTTTCGGGCCGCGACCCCGACCAGCTACAGCAGCTTGTCGCC
AGTATCGAGCAGCTGTGA
Transcript >Ophun1|7108
ATGGCTCCCGCTTCGAAACCCCCTCCTCAAAAGAAGCAGCAGTCTCTGACCTCCTTCTTCACGCCAAAGACGGTC
AATGGATTGGCTGCCTCGTTCGAGAAGCAGAGCCGAAGCCCAGATGCCCAGTCTCGCAAGCGTCCGGCCGACCAA
GACGCCGACGATGCCGACGACGTCCCGCACAAGCCTCAACGCACCGCCAAGAAGCCCAAGACTTCTAATGAAGAC
GATGAGACTCGCTTGCCATCGCCCGCCACAGCTCCTCCAGCACGCGCCCAACGCTATCTCTACGATGCCTCCAGC
TCTGCCCCTGCCCCTGACGACGCCACGAAGCGGGTAAACGAAGACCTACACAGGCGATTCGTCAAGAAGCTCGGC
AACCCAGACGCCTTGACTTGGAAAGGCCGCGCTTCTCTTCAGCAAGCACCTGGGGGCGAAGACGAGGCAGACGCC
GACGACGATGAAGCCGACGAGCAGCCTCCGGCTCCCGCCAAGGCCGGCAAGAAGAACGCCAAGCCGGCGAAGCTG
ACTCCCATGGAGGTTCAGTTCCTCGACATCAAGAGAAAGCACATGGACACTGTCCTCATTGTCGAGGTCGGCTAC
AAGTTTCGCTTCTTTGGTGAGGATGCGCGAATCGCGGCCAAGGAGCTCAGCATCGTTTGCATACCCGGCAAGCTG
CGATACGACGAGCATCCGTCCGAGGCGCACCTGGACCGCTTCGCTTCCGCCAGCATTCCCGTCCACCGACTGTCC
GTCCATGCCAGGCGGCTGGTCGCAGCTGGCCACAAGGTCGGCGTCGTCCGCCAGATCGAAACAGCCGCGCTCAAG
AAGGCGGGCGACAACCGGAACGCCCCCTTTGTCCGAAAGCTCACCAACCTCTACACCAAGGGCACCTACATCGAC
GAAAACGGCGAGCTGGATCAGCAGACGGACGGTGCTCCCTCGGGAGGTTACCTGCTGGCCATCACCGAGACCAAA
TCCAAGGGCTCCGGGACGGATGAAAAGGTCCAAGTCGGCATCCTCGCCGTCCAGCCTGCGACGGGCGACATCGTC
TACGACGTCTTCGAGGACGGCTTCATGCGCAGCGAGGTGGAAACGAGACTGCTGCACATATCGCCCTGCGAATTC
CTCATCGTCGGTGACCTCACCCCGGCCACCAACAAGCTAATCCAGCACCTGTCCGGGAGCAGCACCAACGTCTTC
GGCGACCGCAGCCGCGTCGAGCGCGTATCCCGGAGCTCGACCGCCGGCGCCGAAGCCTCATCGCACGTGGCCCAG
TTCTACGCCGACCGACTCAAAGACGGCTCAACCGACGCCCTCCTCAGCAAGGTCCTGGAGCTGCCGGAGCCAGTA
ACCGTCTGCCTCTCAGCCATGATCAACCACCTCAAAGAGTACGGGCTCGAGCACATCTTCAACCTGACCAAGTAC
TTCCAAGACTTCGGCACCCGCTCCCACGTCCTCATCAACGGAACCACGCTCGAAAGCCTCGAAGTCTACCGCAAC
TCAACCGACCACTCAGAAAAGGGCAGCCTCTTCTGGGCCCTCGACAAGACGCTCACTCGCTTCGGCCAACGCCTC
CTCCGCAAATGGATCGGCCGCCCCCTTCTAGACAGAGACGGCCTCGAGCAAAGAATGGCAGCCGTACAGGAACTC
GTCGACAAGCGTTGCCACCCCCCCGTCGAAGAGCTGGAAAACCTACTGTCCTCCATCAAGCCCGATCTCGAACGC
AGCCTCATCCGCATCTACTACGGAAAATGCACCAGACCCGAGCTCCTATCCGTCCTCCAAACCCTCCAGAAGATT
GCGACCTACTACTCAACCTCAGAATCATCCTCAAGATCCCCCTTCTCTTCCCCCCCCCTCGCAACCTCCGTCCGC
GCCCTCCCCTCCATCCTCAACTCGGTGATAACCTACCTCGACCCCATCGACGCCCAAGCAGCCCGCAAAGACGAC
AAATACGCCTTCTTCCGCTCCCAGCACCAAACAGAAGAAATGCAAGACCACCAGCTCGCCATCGTCCACGTCGAG
CACGAACTCGAAACCCATCGCTCCGCCGCCGCCTCGCAAATCTCAAAGAACAAGGTCGACTACGTCACCGTCGCC
GGCATCGAGTTCCTCATCGAAGTCCCAAACTCAGACGTCAGCCACGTCCCCGCCTCGTGGACCAAAATCTCGGGC
ACAAAGAAGCTCTCCCGCTTTCACACCCCAGACGTCGTCCGCCTCATCGCCGAACGAGATCAACACCGCGAAGCC
CTCGCCGCCGCCTGCGACCGCGCCTTCAAGAACCTCCTCGCAACAATAGCTGCAGACTACCAACCCCTCCGCGAC
GCCGTCTCCGCCCTCGCAACCCTAGATTGCCTCCTCTCGCTGGCAAAGGTCGCCGCCCAACCAGGCTACACCCGT
CCGACCCTCCTCCCCTCCTCCAGCCCTCCCACCATCTCCATCTCCCGCGGCCGCCACCCCATGGCCGAGCATCTC
ATCGACTACATCCCCTTCACAACCAGTCTCGCCCACCCCTCCCCCCTAGCCCACCTGATAACCGGCCCCAACATG
GGCGGCAAATCCTCCTTCGTCCGCGCCCTAGCCCTCATCGTCCTCCTCGCCCAGATAGGCTCCTTCGTCCCCGCA
GACTCCCTCGAGCTCACCCTCTGCGACGCAATCCACACCCGCTCAGGAGCCCACGATAACCTCCTGGCCGGCGAG
TCCACCTTCATGGTCGAGCTCTCGGAGACAGCCCGCATCCTCCAAGCCGCTACGCCCCGAAGCCTCGTCATCCTC
GACGAGCTCGGTCGCGGCACCAGCACCCACGACGGCGCCGCCATCGCCCACGCCGTCCTCCATCACGTCGTCGCC
GAGACCCGTTGTCTTACCCTCTTCATCACCCACTATCAGAATCTCGCCCGCGTCGTAGACGGCCTCGAGGGCGTC
GACAATGTCCATATGCGCTTCAGAGCCGAGGCAGCACCCGCGAGCGAAGATGACGACGCCGCCGGTCATCAAGAC
GATATTACTTTCCTCTACGAAGTCGCCGATGGCGTCGCCCATCGATCCTACGGCCTCAACGTCGCCCGCCTCGCC
CGCATCCCCAAGCACGTCATCGACGTTGCCGCCACAAAGTCGGCCGAGCTTGAGCTCGACGTCAGGAGGCGGAGG
CTGCAGGGTGCCTGTCGAATGCTCCAGTCCGTCGTTTCGGGCCGCGACCCCGACCAGCTACAGCAGCTTGTCGCC
AGTATCGAGCAGCTGTGA
Gene >Ophun1|7108
ATGGCTCCCGCTTCGAAACCCCCTCCTCAAAAGAAGCAGCAGTCTCTGACCTCCTTCTTCACGCCAAAGACGGTC
AATGGATTGGCTGCCTCGTTCGAGAAGCAGAGCCGAAGCCCAGATGCCCAGTCTCGCAAGCGTCCGGCCGACCAA
GACGCCGACGATGCCGACGACGTCCCGCACAAGCCTCAACGCACCGCCAAGAAGCCCAAGACTTCTAATGAAGAC
GATGAGACTCGCTTGCCATCGCCCGCCACAGCTCCTCCAGCACGCGCCCAACGCTATCTCTACGATGCCTCCAGC
TCTGCCCCTGCCCCTGACGACGCCACGAAGCGGGTAAACGAAGACCTACACAGGCGATTCGTCAAGAAGCTCGGC
AACCCAGACGCCTTGACTTGGAAAGGCCGCGCTTCTCTTCAGCAAGCACCTGGGGGCGAAGACGAGGCAGACGCC
GACGACGATGAAGCCGACGAGCAGCCTCCGGCTCCCGCCAAGGCCGGCAAGAAGAACGCCAAGCCGGCGAAGCTG
ACTCCCATGGAGGTTCAGTTCCTCGACATCAAGAGAAAGCACATGGACACTGTCCTCATTGTCGAGGTCGGCTAC
AAGTTTCGCTTCTTTGGTGAGGATGCGCGAATCGCGGCCAAGGAGCTCAGCATCGTTTGCATACCCGGCAAGCTG
CGATACGACGAGCGTACGGACCACCCTCAAACGACTCTTGTTTAACCAAGCACCCTGCTGACTCGGCTTGTAGAT
CCGTCCGAGGCGCACCTGGACCGCTTCGCTTCCGCCAGCATTCCCGTCCACCGACTGTCCGTCCATGCCAGGCGG
CTGGTCGCAGCTGGCCACAAGGTCGGCGTCGTCCGCCAGATCGAAACAGCCGCGCTCAAGAAGGCGGGCGACAAC
CGGAACGCCCCCTTTGTCCGAAAGCTCACCAACCTCTACACCAAGGGCACCTACATCGACGAAAACGGCGAGCTG
GATCAGCAGACGGACGGTGCTCCCTCGGGAGGTTACCTGCTGGCCATCACCGAGACCAAATCCAAGGGCTCCGGG
ACGGATGAAAAGGTCCAAGTCGGCATCCTCGCCGTCCAGCCTGCGACGGGCGACATCGTCTACGACGTCTTCGAG
GACGGCTTCATGCGCAGCGAGGTGGAAACGAGACTGCTGCACATATCGCCCTGCGAATTCCTCATCGTCGGTGAC
CTCACCCCGGCCACCAACAAGCTAATCCAGCACCTGTCCGGGAGCAGCACCAACGTCTTCGGCGACCGCAGCCGC
GTCGAGCGCGTATCCCGGAGCTCGACCGCCGGCGCCGAAGCCTCATCGCACGTGGCCCAGTTCTACGCCGACCGA
CTCAAAGACGGCTCAACCGACGCCCTCCTCAGCAAGGTCCTGGAGCTGCCGGAGCCAGTAACCGTCTGCCTCTCA
GCCATGATCAACCACCTCAAAGAGTACGGGCTCGAGCACATCTTCAACCTGACCAAGTACTTCCAAGACTTCGGC
ACCCGCTCCCACGTCCTCATCAACGGAACCACGCTCGAAAGCCTCGAAGTCTACCGCAACTCAACCGACCACTCA
GAAAAGGGCAGCCTCTTCTGGGCCCTCGACAAGACGCTCACTCGCTTCGGCCAACGCCTCCTCCGCAAATGGATC
GGCCGCCCCCTTCTAGACAGAGACGGCCTCGAGCAAAGAATGGCAGCCGTACAGGAACTCGTCGACAAGCGTTGC
CACCCCCCCGTCGAAGAGCTGGAAAACCTACTGTCCTCCATCAAGCCCGATCTCGAACGCAGCCTCATCCGCATC
TACTACGGAAAATGCACCAGACCCGAGCTCCTATCCGTCCTCCAAACCCTCCAGAAGATTGCGACCTACTACTCA
ACCTCAGAATCATCCTCAAGATCCCCCTTCTCTTCCCCCCCCCTCGCAACCTCCGTCCGCGCCCTCCCCTCCATC
CTCAACTCGGTGATAACCTACCTCGACCCCATCGACGCCCAAGCAGCCCGCAAAGACGACAAATACGCCTTCTTC
CGCTCCCAGCACCAAACAGAAGAAATGCAAGACCACCAGCTCGCCATCGTCCACGTCGAGCACGAACTCGAAACC
CATCGCTCCGCCGCCGCCTCGCAAATCTCAAAGAACAAGGTCGACTACGTCACCGTCGCCGGCATCGAGTTCCTC
ATCGAAGTCCCAAACTCAGACGTCAGCCACGTCCCCGCCTCGTGGACCAAAATCTCGGGCACAAAGAAGCTCTCC
CGCTTTCACACCCCAGACGTCGTCCGCCTCATCGCCGAACGAGATCAACACCGCGAAGCCCTCGCCGCCGCCTGC
GACCGCGCCTTCAAGAACCTCCTCGCAACAATAGCTGCAGACTACCAACCCCTCCGCGACGCCGTCTCCGCCCTC
GCAACCCTAGATTGCCTCCTCTCGCTGGCAAAGGTCGCCGCCCAACCAGGCTACACCCGTCCGACCCTCCTCCCC
TCCTCCAGCCCTCCCACCATCTCCATCTCCCGCGGCCGCCACCCCATGGCCGAGCATCTCATCGACTACATCCCC
TTCACAACCAGTCTCGCCCACCCCTCCCCCCTAGCCCACCTGATAACCGGCCCCAACATGGGCGGCAAATCCTCC
TTCGTCCGCGCCCTAGCCCTCATCGTCCTCCTCGCCCAGATAGGCTCCTTCGTCCCCGCAGACTCCCTCGAGCTC
ACCCTCTGCGACGCAATCCACACCCGCTCAGGAGCCCACGATAACCTCCTGGCCGGCGAGTCCACCTTCATGGTC
GAGCTCTCGGAGACAGCCCGCATCCTCCAAGCCGCTACGCCCCGAAGCCTCGTCATCCTCGACGAGCTCGGTCGC
GGCACCAGCACCCACGACGGCGCCGCCATCGCCCACGCCGTCCTCCATCACGTCGTCGCCGAGACCCGTTGTCTT
ACCCTCTTCATCACCCACTATCAGAATCTCGCCCGCGTCGTAGACGGCCTCGAGGGCGTCGACAATGTCCATATG
CGCTTCAGAGCCGAGGCAGCACCCGCGAGCGAAGATGACGACGCCGCCGGTCATCAAGACGATATTACTTTCCTC
TACGAAGTCGCCGATGGCGTCGCCCATCGATCCTACGGCCTCAACGTCGCCCGCCTCGCCCGCATCCCCAAGCAC
GTCATCGACGTTGCCGCCACAAAGTCGGCCGAGCTTGAGCTCGACGTCAGGAGGCGGAGGCTGCAGGGTGCCTGT
CGAATGCTCCAGTCCGTCGTTTCGGGCCGCGACCCCGACCAGCTACAGCAGCTTGTCGCCAGTATCGAGCAGCTG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail