Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7107
Gene name
LocationContig_85:30228..32961
Strand+
Gene length (bp)2733
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5457
Ophiocordyceps australis map64 (Brazil) OphauB2|3007
Ophiocordyceps camponoti-floridani Ophcf2|07142
Ophiocordyceps camponoti-rufipedis Ophun1|7107 (this protein)
Ophiocordyceps kimflemingae Ophio5|2704
Ophiocordyceps subramaniannii Hirsu2|1093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7107
MNASLTAILQEPAWSASRRDLRAVNMASLANARGSTPGAVNKQIPLLCTVCPDAPRFSDVSHLLTHIASKGHLHH
ETQTRLKSHQDLTAHVVLGQYEQWYKDNGIEALLVERMRAKQLKEAAKTRRARGPATLATLNPKRKTKRPPGSTT
IKSEHDDFARDFPLFPGFFASENDVDIQEDFFVGNDMLSLKGQVWPGMGKMDLANEDMKRTRNQRKPNSVIEKMR
KTSEGIEPTQVIMTSDLEVERIKGVYDSSSPIPGQGEETPKKTSRPKRKRPEPLAEISANIPRGGVRRSGRNTLA
KATRGQRLKLDYDRDTSSDQTPSLGSFRNGHDLFQDDDGSSSGTPLHCALDDVLMDAGIFEDRSFSTPVHQDQRF
DSRDRLALHPLNQITHSNVASPTPSTREMPNRLLSARDANRGRNATHGYLGHGGHMTLGSLAQSDSAFGISDSPM
YGSSARLPFAATNHFGSLAQDSFRLNSGHHQQPKHGEYSSAAGDSLSSSGGSQFLTMSESNPLFSHERLFLSSFS
QQHTSQPLSSLGFTPINRGREQGVATHDHERRTSGPSIKTEPHLCDGLDSGEAKQGPFVSGLWDPQPSENSLDLP
DDLGEELDI*
Coding >Ophun1|7107
ATGAACGCTTCGTTGACTGCGATTCTCCAGGAGCCTGCTTGGTCAGCGAGTCGGCGAGACCTCAGGGCCGTGAAC
ATGGCGTCGCTGGCCAACGCCAGAGGCAGCACGCCCGGCGCCGTCAACAAGCAGATACCACTGCTCTGCACCGTC
TGCCCCGATGCGCCGCGCTTCTCAGACGTTTCTCACTTGCTGACGCACATCGCCTCCAAAGGCCATCTTCACCAT
GAGACGCAGACCAGACTCAAGTCTCACCAGGACCTCACGGCACACGTCGTTCTCGGGCAGTATGAGCAGTGGTAC
AAGGATAATGGCATCGAGGCCCTCTTGGTCGAGCGCATGAGGGCCAAACAGCTGAAAGAGGCTGCCAAAACGAGG
CGCGCAAGGGGCCCCGCTACCTTGGCCACGCTCAATCCCAAGCGCAAGACGAAGCGGCCGCCCGGCTCCACCACC
ATCAAGTCCGAGCACGATGACTTCGCCCGAGATTTCCCATTGTTTCCGGGCTTTTTCGCCTCGGAGAACGATGTC
GACATTCAGGAAGACTTCTTTGTCGGAAACGACATGCTCTCGCTCAAGGGCCAAGTCTGGCCTGGCATGGGCAAG
ATGGACCTAGCCAACGAGGACATGAAGCGAACTCGTAACCAACGCAAGCCGAACTCTGTGATTGAGAAGATGCGC
AAAACTTCTGAAGGCATTGAGCCCACACAGGTGATCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTG
TATGACAGCTCCTCCCCGATCCCCGGCCAGGGAGAAGAGACGCCAAAGAAAACGTCGAGACCCAAGCGCAAAAGG
CCTGAGCCGTTGGCAGAAATCTCGGCCAATATTCCTCGGGGCGGTGTCCGTCGGTCAGGTCGCAACACCCTGGCC
AAGGCCACCCGAGGGCAGCGCCTCAAGCTGGATTACGATCGCGACACGAGTTCGGATCAGACGCCGTCACTTGGT
TCCTTCAGGAATGGTCACGATTTGTTCCAAGACGATGACGGTTCCTCCTCGGGTACGCCGCTTCATTGCGCTCTC
GATGACGTGCTGATGGACGCAGGCATCTTCGAAGATCGTTCATTCTCCACGCCCGTGCATCAAGATCAAAGGTTC
GATTCGCGGGACCGACTCGCGCTCCATCCCCTCAACCAAATAACCCACTCGAATGTGGCCTCGCCTACTCCCTCC
ACCAGAGAGATGCCCAACCGCCTTCTCTCCGCTCGAGATGCGAATCGAGGGAGGAATGCGACACACGGATACCTT
GGGCATGGCGGGCACATGACGTTGGGCTCTCTCGCGCAATCCGACTCTGCGTTTGGCATCAGTGATTCGCCCATG
TACGGCAGTTCAGCGAGGCTCCCCTTCGCTGCCACCAACCACTTCGGCTCTCTCGCCCAAGACAGCTTTCGCCTC
AATTCTGGCCACCATCAGCAGCCCAAGCATGGAGAGTACTCTTCGGCGGCCGGCGACTCGCTGTCGAGCTCGGGC
GGGAGCCAGTTCTTGACCATGTCTGAGTCAAACCCTCTCTTCTCTCACGAGCGTCTTTTCCTCTCCTCTTTCAGC
CAGCAGCACACGAGCCAGCCTCTGTCCTCTCTCGGTTTCACGCCTATCAATCGAGGCCGCGAACAAGGCGTTGCC
ACCCACGACCATGAGCGGCGGACGTCCGGTCCCAGTATCAAGACAGAGCCGCATCTGTGCGATGGCCTCGACAGT
GGTGAAGCGAAGCAGGGTCCCTTTGTCAGCGGCTTGTGGGATCCGCAGCCGTCGGAGAACAGCTTGGATCTTCCC
GATGACCTCGGTGAAGAGTTGGACATTTGA
Transcript >Ophun1|7107
ATGAACGCTTCGTTGACTGCGATTCTCCAGGAGCCTGCTTGGTCAGCGAGTCGGCGAGACCTCAGGGCCGTGAAC
ATGGCGTCGCTGGCCAACGCCAGAGGCAGCACGCCCGGCGCCGTCAACAAGCAGATACCACTGCTCTGCACCGTC
TGCCCCGATGCGCCGCGCTTCTCAGACGTTTCTCACTTGCTGACGCACATCGCCTCCAAAGGCCATCTTCACCAT
GAGACGCAGACCAGACTCAAGTCTCACCAGGACCTCACGGCACACGTCGTTCTCGGGCAGTATGAGCAGTGGTAC
AAGGATAATGGCATCGAGGCCCTCTTGGTCGAGCGCATGAGGGCCAAACAGCTGAAAGAGGCTGCCAAAACGAGG
CGCGCAAGGGGCCCCGCTACCTTGGCCACGCTCAATCCCAAGCGCAAGACGAAGCGGCCGCCCGGCTCCACCACC
ATCAAGTCCGAGCACGATGACTTCGCCCGAGATTTCCCATTGTTTCCGGGCTTTTTCGCCTCGGAGAACGATGTC
GACATTCAGGAAGACTTCTTTGTCGGAAACGACATGCTCTCGCTCAAGGGCCAAGTCTGGCCTGGCATGGGCAAG
ATGGACCTAGCCAACGAGGACATGAAGCGAACTCGTAACCAACGCAAGCCGAACTCTGTGATTGAGAAGATGCGC
AAAACTTCTGAAGGCATTGAGCCCACACAGGTGATCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTG
TATGACAGCTCCTCCCCGATCCCCGGCCAGGGAGAAGAGACGCCAAAGAAAACGTCGAGACCCAAGCGCAAAAGG
CCTGAGCCGTTGGCAGAAATCTCGGCCAATATTCCTCGGGGCGGTGTCCGTCGGTCAGGTCGCAACACCCTGGCC
AAGGCCACCCGAGGGCAGCGCCTCAAGCTGGATTACGATCGCGACACGAGTTCGGATCAGACGCCGTCACTTGGT
TCCTTCAGGAATGGTCACGATTTGTTCCAAGACGATGACGGTTCCTCCTCGGGTACGCCGCTTCATTGCGCTCTC
GATGACGTGCTGATGGACGCAGGCATCTTCGAAGATCGTTCATTCTCCACGCCCGTGCATCAAGATCAAAGGTTC
GATTCGCGGGACCGACTCGCGCTCCATCCCCTCAACCAAATAACCCACTCGAATGTGGCCTCGCCTACTCCCTCC
ACCAGAGAGATGCCCAACCGCCTTCTCTCCGCTCGAGATGCGAATCGAGGGAGGAATGCGACACACGGATACCTT
GGGCATGGCGGGCACATGACGTTGGGCTCTCTCGCGCAATCCGACTCTGCGTTTGGCATCAGTGATTCGCCCATG
TACGGCAGTTCAGCGAGGCTCCCCTTCGCTGCCACCAACCACTTCGGCTCTCTCGCCCAAGACAGCTTTCGCCTC
AATTCTGGCCACCATCAGCAGCCCAAGCATGGAGAGTACTCTTCGGCGGCCGGCGACTCGCTGTCGAGCTCGGGC
GGGAGCCAGTTCTTGACCATGTCTGAGTCAAACCCTCTCTTCTCTCACGAGCGTCTTTTCCTCTCCTCTTTCAGC
CAGCAGCACACGAGCCAGCCTCTGTCCTCTCTCGGTTTCACGCCTATCAATCGAGGCCGCGAACAAGGCGTTGCC
ACCCACGACCATGAGCGGCGGACGTCCGGTCCCAGTATCAAGACAGAGCCGCATCTGTGCGATGGCCTCGACAGT
GGTGAAGCGAAGCAGGGTCCCTTTGTCAGCGGCTTGTGGGATCCGCAGCCGTCGGAGAACAGCTTGGATCTTCCC
GATGACCTCGGTGAAGAGTTGGACATTTGA
Gene >Ophun1|7107
ATGAACGCTTCGTTGACTGCGATTCTCCAGGAGCCTGCTTGGTCAGCGAGTCGGCGAGACCTCAGGGCCGTGGTG
GGTGGACGGCGGTGAGAGTGGCGGAAGGTGCGAAGCAGGTGGACGAGGCTCTTTCCCTCCCCTCAACGCCCTCGC
CGACAAATTCTGTCGCTGCCTGAGGCTCTCTTTGCCTCCGTCTCTTTGCTCGTCTCTTCTCCCCTCCTTTCGTCC
CAAAATCTCGCACCCTCCTCTTTCATCCGCTCCTCTTCAGACTGCAAGGTGCCGCCGCTCTTGCCCACGACAGCG
CCGGAAAGCTTCTAGAAAAACTCCTGGCCGCTGAAGCTGCCGCATCCGCTGCTCTTCCCGCAGCTTCGCTCGCAT
GAACTGGCGAGCAAGACGTTCAGCAGGTGCGAGTTCGCGCCTGGCTGCACTTCCCCTGGTGAGAACCTCGCTTCC
ATCTCCTCGTTCCTCAGTCCCCACCAAGAGACCGGCCCGGCTCAGGGCTGCCGTCGCCGACTCCTCTCCCTTTTC
CCTCCCACCGCTCCAGTTGCTCTTTGCCTCCCCAGATTGCTTCCACTGCGTGCTGTGTGCTCTGGCTTTCCGGAA
CTGTTGCTGCCTTCGCCACGTTCCTGCTGCTCGCCCTCCATCGGGGTGCTGATCCAGCCAGGCCGCATTGTCAGT
CCGCAGTGCCCAGACAGACCAGACACTCTCCTGCTCTCGCTCGTTCGCAAAGCATGGCTGACTCGTCATCCCGCA
GAACATGGCGTCGCTGGCCAACGCCAGAGGCAGCACGCCCGGCGCCGTCAACAAGCAGATACCACTGCTCTGCAC
CGTCTGCCCCGATGCGCCGCGCTTCTCAGACGTTTCTCACTTGCTGACGCACATCGCCTCCAAAGGCCATCTTCA
CCATGAGACGCAGACCAGACTCAAGTCTCACCAGGACCTCACGGCACACGTCGTTCTCGGGCAGTATGAGCAGTG
GTACAAGGATAATGGCATCGAGGCCCTCTTGGTCGAGCGCATGAGGGCCAAACAGCTGAAAGAGGCTGCCAAAAC
GAGGCGCGCAAGGGGCCCCGCTACCTTGGCCACGCTCAATGTATGTGCCTCGCCCGCGGGACTGGCGAACTCATG
TTGATGCTGGAAGCAGCCCAAGCGCAAGACGAAGCGGCCGCCCGGCTCCACCACCATCAAGTCCGAGCACGATGA
CTTCGCCCGAGATTTCCCATTGTTTCCGGGCTTTTTCGCCTCGGAGAACGATGTCGACATTCAGGAAGACTTCTT
TGTCGGAAACGACATGCTCTCGCTCAAGGGCCAAGTCTGGCCTGGCATGGGCAAGATGGACCTAGCCAACGAGGA
CATGAAGCGAACTCGTAACCAACGCAAGCCGAACTCTGTGATTGAGAAGATGCGCAAAACTTCTGAAGGCATTGA
GCCCACACAGGTGATCATGACCTCTGATCTCGAGGTGGAGAGGATCAAAGGAGTGTATGACAGCTCCTCCCCGAT
CCCCGGCCAGGGAGAAGAGGTGAGAGGGACTCTCGGTGCTTCGTCACCAAGAATGAAGCTGATCCTGGCAGACGC
CAAAGAAAACGTCGAGACCCAAGCGCAAAAGGCCTGAGCCGTTGGCAGAAATCTCGGCCAATATTCCTCGGGGCG
GTGTCCGTCGGTCAGGTCGCAACACCCTGGCCAAGGCCACCCGAGGGCAGCGCCTCAAGCTGGATTACGATCGCG
ACACGAGTTCGGATCAGACGCCGTCACTTGGTTCCTTCAGGAATGGTCACGATTTGTTCCAAGACGATGACGGTT
CCTCCTCGGGTACGCCGCTTCATTGCGCTCTCGATGACGTGCTGATGGACGCAGGCATCTTCGAAGATCGTTCAT
TCTCCACGCCCGTGCATCAAGATCAAAGGTACGACGGTCATGGCCTGCCTCTAATTAGCTTTTCAACGAGCTCAC
GACGCATCAGGTTCGATTCGCGGGACCGACTCGCGCTCCATCCCCTCAACCAAATAACCCACTCGAATGTGGCCT
CGCCTACTCCCTCCACCAGAGAGATGCCCAACCGCCTTCTCTCCGCTCGAGATGCGAATCGAGGGAGGAATGCGA
CACACGGATACCTTGGGCATGGCGGGCACATGACGTTGGGTAAGTCATCGATTGGTTGGCCAAGGGGATTCGTTG
AGACGCGGATGACCTGACGAAACGCAAGGCTCTCTCGCGCAATCCGACTCTGCGTTTGGCATCAGTGATTCGCCC
ATGTACGGCAGTTCAGCGAGGCTCCCCTTCGCTGCCACCAACCACTTCGGCTCTCTCGCCCAAGACAGCTTTCGC
CTCAATTCTGGCCACCATCAGCAGCCCAAGCATGGAGAGTACTCTTCGGCGGCCGGCGACTCGCTGTCGAGCTCG
GGCGGGAGCCAGTTCTTGACCATGTCTGAGTCAAACCCTCTCTTCTCTCACGAGCGTCTTTTCCTCTCCTCTTTC
AGCCAGCAGCACACGAGCCAGCCTCTGTCCTCTCTCGGTTTCACGCCTATCAATCGAGGCCGCGAACAAGGCGTT
GCCACCCACGACCATGAGCGGCGGACGTCCGGTCCCAGTATCAAGACAGAGCCGCATCTGTGCGATGGCCTCGAC
AGTGGTGAAGCGAAGCAGGGTCCCTTTGTCAGCGGCTTGTGGGATCCGCAGCCGTCGGAGAACAGCTTGGATCTT
CCCGATGACCTCGGTGAAGAGTTGGACATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail