Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7088
Gene name
LocationContig_846:35..4000
Strand-
Gene length (bp)3965
Transcript length (bp)3918
Coding sequence length (bp)3918
Protein length (aa) 1306

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00271 Helicase_C Helicase conserved C-terminal domain 3.5E-16 834 958
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 9.6E-15 1178 1279
PF04408 HA2 Helicase associated domain (HA2) 6.7E-14 1022 1101
PF00270 DEAD DEAD/DEAH box helicase 5.3E-09 602 757

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 54 1302 0.0E+00
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 1 1303 0.0E+00
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 69 1303 4.0E-180
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 580 1304 1.0E-132
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 561 1304 3.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 54 1302 0.0E+00
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 1 1303 0.0E+00
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 69 1303 4.0E-180
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 580 1304 1.0E-132
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 561 1304 3.0E-129
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 585 1296 1.0E-128
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 561 1304 6.0E-128
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 572 1296 3.0E-125
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 579 1296 4.0E-124
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 582 1296 2.0E-119
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 567 1303 3.0E-117
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 574 1303 4.0E-117
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 545 1301 1.0E-116
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 579 1303 1.0E-109
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 565 1279 1.0E-107
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 572 1296 1.0E-96
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 585 1297 1.0E-93
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 585 1297 1.0E-93
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 580 1297 6.0E-93
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 581 1163 1.0E-91
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 581 1163 1.0E-91
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 519 1296 2.0E-91
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 589 1275 9.0E-91
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 571 1286 9.0E-91
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 571 1286 5.0E-90
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 571 1286 7.0E-90
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 581 1297 1.0E-89
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 571 1275 1.0E-89
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 571 1286 2.0E-89
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 556 1291 5.0E-88
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 580 1273 1.0E-87
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 585 1297 1.0E-87
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 582 1268 3.0E-87
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 577 1265 3.0E-87
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 579 1265 3.0E-87
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 577 1265 4.0E-87
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 577 1265 4.0E-87
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 579 1265 3.0E-86
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 573 1265 4.0E-86
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 570 1277 2.0E-85
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 582 1273 2.0E-84
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 579 1268 3.0E-84
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 582 1273 4.0E-84
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 589 1117 5.0E-84
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 579 1265 7.0E-84
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 580 1267 2.0E-83
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 580 1273 5.0E-83
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 585 1259 1.0E-82
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 570 1273 1.0E-82
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 585 1279 5.0E-82
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 585 1279 8.0E-82
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 578 1250 1.0E-81
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 580 1272 3.0E-81
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 556 1250 6.0E-81
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 586 1267 1.0E-80
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 582 1273 1.0E-80
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 578 1250 3.0E-80
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 582 1273 3.0E-80
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 582 1273 3.0E-80
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 586 1269 1.0E-79
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 574 1273 9.0E-79
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 586 1269 3.0E-78
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 582 1273 2.0E-77
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 568 1195 2.0E-77
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 575 1267 4.0E-77
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 580 1272 6.0E-77
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 582 1268 2.0E-76
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 585 1269 3.0E-75
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 585 1269 9.0E-75
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 585 1259 2.0E-74
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 553 1269 8.0E-74
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 588 1189 2.0E-73
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 576 1267 6.0E-73
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 589 1268 2.0E-72
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 577 1269 8.0E-72
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 582 1273 6.0E-71
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 582 1263 7.0E-71
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 585 1278 6.0E-70
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 582 1194 4.0E-69
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 574 1114 7.0E-69
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 586 1265 7.0E-68
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 587 1083 7.0E-68
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 488 1109 1.0E-67
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 564 1105 1.0E-66
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 587 1083 1.0E-66
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 581 1235 2.0E-66
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 589 1195 4.0E-66
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 577 1279 2.0E-65
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 589 1177 7.0E-65
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 565 1079 7.0E-64
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 598 1082 2.0E-63
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 562 1206 8.0E-63
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 587 1083 2.0E-62
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 573 1267 2.0E-62
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 573 1267 4.0E-62
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 573 1267 4.0E-62
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 573 1267 6.0E-62
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 587 1101 6.0E-62
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 686 1177 2.0E-61
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 579 1228 3.0E-61
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 598 1082 3.0E-60
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 569 1248 5.0E-60
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 820 1235 1.0E-56
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 820 1235 2.0E-56
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 831 1193 3.0E-54
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 598 1118 1.0E-47
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 836 1193 4.0E-47
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 589 1078 1.0E-45
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 581 798 1.0E-43
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 581 798 1.0E-43
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 571 888 3.0E-41
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 580 795 4.0E-40
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 866 1235 1.0E-39
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 608 1058 5.0E-39
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 866 1265 4.0E-32
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 590 1079 6.0E-32
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 578 1117 7.0E-32
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 581 947 2.0E-31
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 579 1192 2.0E-31
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 581 865 3.0E-29
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 581 865 4.0E-29
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 870 1286 5.0E-29
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 580 865 1.0E-28
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 579 1192 1.0E-28
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 581 868 2.0E-28
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 579 1192 6.0E-28
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 870 1276 6.0E-26
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 870 1058 3.0E-24
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 579 1117 5.0E-23
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 607 983 8.0E-23
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 607 983 9.0E-23
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 607 983 9.0E-23
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 607 983 1.0E-22
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 607 983 1.0E-22
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 579 1117 3.0E-22
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 981 1281 9.0E-21
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 822 1091 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3636
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1227
Ophiocordyceps australis map64 (Brazil) OphauB2|5823
Ophiocordyceps camponoti-floridani Ophcf2|04859
Ophiocordyceps camponoti-rufipedis Ophun1|7088 (this protein)
Ophiocordyceps kimflemingae Ophio5|7019
Ophiocordyceps subramaniannii Hirsu2|7019

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7088
MVKKAKDKSEKATTASAGPSGAPNGSKDGGKGKKGQKKTEPVAAPAPAPAAPPKPTVKQIIGGSSWTGKLPVNLL
SEHCQRQRWEKPEYDTRRTAEGFSVWVTLSGRDAKTQQLTRLEPFKIPASHKHLLVRQTALEAKHAAATYALFRV
CNMQNKHTVLPPDHKSLWKEFQALKAQDVKEGKAWMYEADPFKTLLERQENKAAAEKKRTEMEAARAKAKEMPGA
SGLVLLNSAGAAGGNAMKGWMTAPKVEMGRQTRLQLEALLRKGISWNPNGIRMSRAQRDGVVDDLTKIGFRRSHV
AEAAEYCKDREETLEWLLIHVPEDDLPRWAFPEKYAAGVSVGATNLRREGIVKSLSETGYAPELCARAFDDNDGD
EVRAAEALQAMLFPPAPTSGEDFLNMGEPDEQWAEEVASLEAMYGDGLVREDEQTIRVRLEAVRDAQDSHKGEVE
AHLRIRRSSTYPEHLILGVVGKLPSYMKLSIVRKALEYSDESLRDEPLKMYLVTDWVQQNINGIIDDPGKLVDIS
AVASAACDGRPKEASQAKAINSTKTRGPARRTISWTADARSREDWLKRQQRPCWREMEAKRRRLPAWRMNDCIVR
TVEEHDVTIISGETGSGKSTQSVQFILDDLYERGLGEQANMLVTQPRRISALGLADRVAEERCSRVGEEVGYAIR
GEARRSERTRITFMTTGVLLRRLQTSGGRMEDVAASLADASHVVIDEVHERSLDTDFLLTLLREVLRGGGGPKLI
LMSATLDAASFRHYFASEGLTVGLVEIAGRTFPVDEFYLDDVLRMNSYAPDWEPDSETSAVGRTMKRLAQRMDYD
LLAETVRSIDRQLSAEKQTGAILVFLAGVAEISQACGRLRATSSLQVFPLHGSLETGEQRRVFGRPAPGKRKVVV
ATNVAETSITIDDVVVVIDSGKVKETSLDATNNNMRRLEERWASRAACEQRRGRAGRVCEGRCYRLYTRQTEQQM
APRPEPEMRRVPLEQLCLSVRAMGFRDVAGFLDRCPTAPSGPAVDAALRLLGRMGALDGSELTVLGRQLANLPAD
LRCGKLMILGGLLGCLHDCVAMAAILSTRSPFVTPPPERRDAAREARMAFDRGDGDVLTDLAALEAWEEESRRRP
GGRQMRVFCDDNFLSMQALNDIVATRTQLYTALAEMGLGRDTDDSRDRDTQLLRSLVAAAFAPQVARIQYPDRKY
ASGMSGAIELDPEARAIKYYTQESGRVFVHPASTLFGSQAFTGDAAYVSYFGIMATTKVFIRDLTPLNAYGLLLF
CGAIELDTLGRGLVVDGWIRLRGWARIGEG*
Coding >Ophun1|7088
ATGGTCAAAAAGGCCAAAGACAAGAGCGAAAAGGCGACGACTGCATCGGCAGGCCCGTCAGGCGCGCCCAACGGC
TCCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGACGGAGCCCGTGGCAGCACCAGCCCCGGCACCGGCA
GCACCCCCGAAGCCGACAGTCAAGCAAATCATCGGAGGCTCGTCATGGACCGGAAAGCTGCCTGTCAACCTGCTG
AGCGAGCACTGTCAGAGGCAGCGGTGGGAGAAGCCCGAGTACGACACGCGCAGGACGGCCGAAGGCTTCTCGGTT
TGGGTGACGCTGAGCGGGCGAGACGCCAAGACGCAGCAGCTCACGCGGCTGGAGCCCTTCAAGATCCCGGCTAGT
CACAAGCACCTTTTGGTGAGGCAGACGGCGCTGGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTT
TGCAACATGCAGAACAAGCACACGGTGCTTCCGCCGGATCACAAGTCGCTGTGGAAGGAGTTCCAGGCGCTCAAG
GCGCAGGACGTCAAGGAGGGCAAGGCGTGGATGTACGAGGCCGACCCGTTCAAGACGCTGCTGGAGCGGCAGGAG
AACAAGGCGGCGGCGGAGAAGAAGAGGACGGAGATGGAGGCGGCCAGGGCAAAGGCAAAGGAGATGCCGGGGGCT
TCGGGCTTGGTTCTGCTCAACAGCGCGGGAGCCGCGGGCGGCAACGCCATGAAGGGCTGGATGACGGCGCCCAAG
GTCGAGATGGGCAGGCAGACGAGGTTGCAGCTCGAGGCGCTCCTGCGAAAGGGCATCTCGTGGAATCCCAACGGC
ATCCGCATGAGTCGGGCGCAGAGGGATGGTGTCGTCGACGACCTGACCAAGATTGGCTTCCGACGCAGCCACGTG
GCTGAAGCGGCGGAATACTGCAAGGACCGCGAGGAGACGCTCGAATGGCTGCTCATCCACGTTCCCGAAGACGAT
CTGCCGCGATGGGCCTTTCCGGAGAAATACGCGGCCGGAGTTTCGGTGGGCGCGACCAATCTGAGGCGGGAGGGC
ATCGTCAAGTCGCTGTCGGAGACGGGGTACGCGCCTGAGCTGTGTGCGCGAGCCTTTGACGATAACGACGGCGAC
GAGGTCCGGGCGGCGGAGGCGCTGCAGGCGATGCTCTTCCCGCCGGCTCCCACGTCGGGCGAAGACTTCCTGAAC
ATGGGGGAGCCCGACGAGCAGTGGGCGGAAGAGGTGGCGAGCCTGGAGGCCATGTACGGTGATGGTCTAGTACGC
GAGGACGAGCAGACGATCCGGGTGCGGCTGGAGGCGGTACGTGACGCGCAGGACTCTCACAAGGGCGAGGTTGAG
GCGCATCTGCGGATCCGGCGATCGTCGACGTATCCCGAGCACCTGATATTGGGCGTCGTCGGCAAGCTACCGTCG
TACATGAAGCTCAGCATCGTCCGGAAGGCATTGGAGTACTCGGACGAGTCGCTGCGAGACGAGCCCCTGAAGATG
TACCTGGTGACGGATTGGGTGCAGCAGAATATCAACGGCATCATCGATGACCCGGGAAAGCTCGTCGACATCTCG
GCTGTGGCTTCGGCCGCGTGCGATGGTCGGCCAAAGGAGGCGTCGCAGGCCAAGGCGATCAACTCGACCAAGACG
CGGGGCCCGGCTCGGAGGACCATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGACTGGCTCAAGCGGCAGCAG
CGGCCGTGCTGGAGAGAGATGGAGGCCAAGCGGCGTCGGCTGCCGGCGTGGCGGATGAACGACTGCATCGTTCGG
ACGGTGGAAGAGCACGATGTGACCATCATCAGTGGCGAGACGGGCTCAGGCAAGTCGACGCAGTCGGTGCAGTTC
ATCCTCGACGATCTCTACGAGCGTGGCCTCGGCGAGCAGGCCAACATGCTGGTGACGCAGCCGCGACGCATCTCG
GCGTTGGGGTTGGCGGACCGAGTGGCGGAGGAGCGATGCTCGCGGGTGGGCGAAGAAGTCGGTTATGCCATCCGT
GGCGAGGCTCGACGATCGGAGCGGACGCGAATCACGTTTATGACGACGGGCGTGCTGCTGAGGCGACTGCAGACG
TCTGGTGGACGGATGGAGGACGTGGCGGCGTCTCTGGCGGACGCGAGTCACGTCGTCATCGATGAGGTTCACGAG
AGGAGTCTCGATACCGACTTCTTACTGACGCTGTTGCGTGAGGTGCTGAGAGGAGGAGGCGGGCCGAAGCTGATT
CTCATGTCGGCCACGCTGGATGCCGCCTCGTTCCGGCATTACTTTGCGTCCGAGGGCCTGACGGTCGGGCTGGTG
GAGATTGCTGGCAGGACGTTTCCGGTCGACGAGTTTTACCTGGACGATGTGCTGAGGATGAACTCGTACGCGCCG
GACTGGGAGCCGGACTCGGAGACTTCGGCTGTCGGACGGACGATGAAGCGGCTGGCCCAGCGGATGGACTATGAC
CTGCTGGCCGAGACGGTGCGGTCCATCGATCGGCAGCTCAGCGCCGAGAAGCAGACGGGTGCCATCCTCGTCTTC
CTGGCGGGCGTGGCCGAGATCAGCCAGGCCTGTGGACGGCTGCGGGCGACGAGCTCACTCCAGGTGTTTCCCCTT
CACGGATCTCTCGAGACTGGCGAGCAGAGACGAGTCTTTGGCCGGCCAGCCCCGGGCAAGCGAAAGGTGGTGGTG
GCAACCAACGTGGCGGAGACTTCCATCACCATCGATGACGTCGTCGTCGTCATTGACAGCGGCAAGGTCAAGGAG
ACGAGCCTCGACGCGACCAATAACAACATGCGCCGGCTGGAGGAGCGCTGGGCGTCTCGGGCCGCGTGCGAGCAG
AGGCGCGGACGGGCGGGACGCGTCTGCGAAGGCCGCTGCTACCGGCTGTACACGCGACAGACGGAGCAGCAGATG
GCTCCGCGGCCCGAGCCCGAGATGCGTCGGGTGCCGCTGGAGCAGCTGTGTCTGTCGGTGCGGGCCATGGGCTTC
CGTGACGTCGCCGGCTTCCTCGACCGGTGTCCTACGGCGCCGTCCGGGCCGGCTGTTGATGCCGCCTTGCGTCTG
CTGGGCCGGATGGGCGCTCTCGACGGCTCGGAGCTGACGGTGTTGGGACGCCAGCTGGCCAATCTACCGGCCGAT
CTGCGCTGCGGGAAGCTGATGATCCTAGGCGGACTGCTGGGCTGTCTACACGACTGTGTCGCCATGGCCGCCATC
CTGAGCACGCGGAGTCCGTTCGTGACGCCTCCGCCCGAGAGACGTGATGCCGCTCGCGAGGCCAGGATGGCCTTT
GATCGTGGCGACGGGGACGTCCTCACCGATCTAGCCGCGCTCGAGGCCTGGGAAGAGGAGAGCCGGAGACGGCCG
GGGGGTCGTCAGATGCGCGTCTTTTGCGACGACAACTTCTTGTCAATGCAGGCGCTCAACGACATTGTGGCCACG
CGGACGCAGCTGTACACGGCCCTGGCCGAGATGGGACTCGGGAGGGACACGGACGACAGCCGGGATCGGGACACG
CAGCTGCTCCGGAGCCTGGTGGCGGCGGCCTTTGCTCCACAGGTGGCCCGGATCCAATACCCGGACCGCAAGTAC
GCCAGCGGCATGTCGGGCGCCATCGAGCTGGACCCAGAGGCGAGGGCTATCAAGTACTACACGCAGGAGAGCGGA
CGCGTCTTCGTCCACCCGGCCAGCACCCTCTTCGGGAGCCAGGCATTCACGGGGGACGCAGCGTACGTGTCCTAC
TTTGGCATCATGGCGACGACCAAGGTCTTTATCCGCGACCTGACGCCCCTCAACGCCTACGGCCTCCTGCTCTTC
TGCGGCGCCATCGAGCTGGACACGCTGGGGAGGGGTCTGGTGGTGGACGGTTGGATACGGCTTCGCGGCTGGGCT
CGTATCGGGGAGGGTTGA
Transcript >Ophun1|7088
ATGGTCAAAAAGGCCAAAGACAAGAGCGAAAAGGCGACGACTGCATCGGCAGGCCCGTCAGGCGCGCCCAACGGC
TCCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGACGGAGCCCGTGGCAGCACCAGCCCCGGCACCGGCA
GCACCCCCGAAGCCGACAGTCAAGCAAATCATCGGAGGCTCGTCATGGACCGGAAAGCTGCCTGTCAACCTGCTG
AGCGAGCACTGTCAGAGGCAGCGGTGGGAGAAGCCCGAGTACGACACGCGCAGGACGGCCGAAGGCTTCTCGGTT
TGGGTGACGCTGAGCGGGCGAGACGCCAAGACGCAGCAGCTCACGCGGCTGGAGCCCTTCAAGATCCCGGCTAGT
CACAAGCACCTTTTGGTGAGGCAGACGGCGCTGGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTT
TGCAACATGCAGAACAAGCACACGGTGCTTCCGCCGGATCACAAGTCGCTGTGGAAGGAGTTCCAGGCGCTCAAG
GCGCAGGACGTCAAGGAGGGCAAGGCGTGGATGTACGAGGCCGACCCGTTCAAGACGCTGCTGGAGCGGCAGGAG
AACAAGGCGGCGGCGGAGAAGAAGAGGACGGAGATGGAGGCGGCCAGGGCAAAGGCAAAGGAGATGCCGGGGGCT
TCGGGCTTGGTTCTGCTCAACAGCGCGGGAGCCGCGGGCGGCAACGCCATGAAGGGCTGGATGACGGCGCCCAAG
GTCGAGATGGGCAGGCAGACGAGGTTGCAGCTCGAGGCGCTCCTGCGAAAGGGCATCTCGTGGAATCCCAACGGC
ATCCGCATGAGTCGGGCGCAGAGGGATGGTGTCGTCGACGACCTGACCAAGATTGGCTTCCGACGCAGCCACGTG
GCTGAAGCGGCGGAATACTGCAAGGACCGCGAGGAGACGCTCGAATGGCTGCTCATCCACGTTCCCGAAGACGAT
CTGCCGCGATGGGCCTTTCCGGAGAAATACGCGGCCGGAGTTTCGGTGGGCGCGACCAATCTGAGGCGGGAGGGC
ATCGTCAAGTCGCTGTCGGAGACGGGGTACGCGCCTGAGCTGTGTGCGCGAGCCTTTGACGATAACGACGGCGAC
GAGGTCCGGGCGGCGGAGGCGCTGCAGGCGATGCTCTTCCCGCCGGCTCCCACGTCGGGCGAAGACTTCCTGAAC
ATGGGGGAGCCCGACGAGCAGTGGGCGGAAGAGGTGGCGAGCCTGGAGGCCATGTACGGTGATGGTCTAGTACGC
GAGGACGAGCAGACGATCCGGGTGCGGCTGGAGGCGGTACGTGACGCGCAGGACTCTCACAAGGGCGAGGTTGAG
GCGCATCTGCGGATCCGGCGATCGTCGACGTATCCCGAGCACCTGATATTGGGCGTCGTCGGCAAGCTACCGTCG
TACATGAAGCTCAGCATCGTCCGGAAGGCATTGGAGTACTCGGACGAGTCGCTGCGAGACGAGCCCCTGAAGATG
TACCTGGTGACGGATTGGGTGCAGCAGAATATCAACGGCATCATCGATGACCCGGGAAAGCTCGTCGACATCTCG
GCTGTGGCTTCGGCCGCGTGCGATGGTCGGCCAAAGGAGGCGTCGCAGGCCAAGGCGATCAACTCGACCAAGACG
CGGGGCCCGGCTCGGAGGACCATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGACTGGCTCAAGCGGCAGCAG
CGGCCGTGCTGGAGAGAGATGGAGGCCAAGCGGCGTCGGCTGCCGGCGTGGCGGATGAACGACTGCATCGTTCGG
ACGGTGGAAGAGCACGATGTGACCATCATCAGTGGCGAGACGGGCTCAGGCAAGTCGACGCAGTCGGTGCAGTTC
ATCCTCGACGATCTCTACGAGCGTGGCCTCGGCGAGCAGGCCAACATGCTGGTGACGCAGCCGCGACGCATCTCG
GCGTTGGGGTTGGCGGACCGAGTGGCGGAGGAGCGATGCTCGCGGGTGGGCGAAGAAGTCGGTTATGCCATCCGT
GGCGAGGCTCGACGATCGGAGCGGACGCGAATCACGTTTATGACGACGGGCGTGCTGCTGAGGCGACTGCAGACG
TCTGGTGGACGGATGGAGGACGTGGCGGCGTCTCTGGCGGACGCGAGTCACGTCGTCATCGATGAGGTTCACGAG
AGGAGTCTCGATACCGACTTCTTACTGACGCTGTTGCGTGAGGTGCTGAGAGGAGGAGGCGGGCCGAAGCTGATT
CTCATGTCGGCCACGCTGGATGCCGCCTCGTTCCGGCATTACTTTGCGTCCGAGGGCCTGACGGTCGGGCTGGTG
GAGATTGCTGGCAGGACGTTTCCGGTCGACGAGTTTTACCTGGACGATGTGCTGAGGATGAACTCGTACGCGCCG
GACTGGGAGCCGGACTCGGAGACTTCGGCTGTCGGACGGACGATGAAGCGGCTGGCCCAGCGGATGGACTATGAC
CTGCTGGCCGAGACGGTGCGGTCCATCGATCGGCAGCTCAGCGCCGAGAAGCAGACGGGTGCCATCCTCGTCTTC
CTGGCGGGCGTGGCCGAGATCAGCCAGGCCTGTGGACGGCTGCGGGCGACGAGCTCACTCCAGGTGTTTCCCCTT
CACGGATCTCTCGAGACTGGCGAGCAGAGACGAGTCTTTGGCCGGCCAGCCCCGGGCAAGCGAAAGGTGGTGGTG
GCAACCAACGTGGCGGAGACTTCCATCACCATCGATGACGTCGTCGTCGTCATTGACAGCGGCAAGGTCAAGGAG
ACGAGCCTCGACGCGACCAATAACAACATGCGCCGGCTGGAGGAGCGCTGGGCGTCTCGGGCCGCGTGCGAGCAG
AGGCGCGGACGGGCGGGACGCGTCTGCGAAGGCCGCTGCTACCGGCTGTACACGCGACAGACGGAGCAGCAGATG
GCTCCGCGGCCCGAGCCCGAGATGCGTCGGGTGCCGCTGGAGCAGCTGTGTCTGTCGGTGCGGGCCATGGGCTTC
CGTGACGTCGCCGGCTTCCTCGACCGGTGTCCTACGGCGCCGTCCGGGCCGGCTGTTGATGCCGCCTTGCGTCTG
CTGGGCCGGATGGGCGCTCTCGACGGCTCGGAGCTGACGGTGTTGGGACGCCAGCTGGCCAATCTACCGGCCGAT
CTGCGCTGCGGGAAGCTGATGATCCTAGGCGGACTGCTGGGCTGTCTACACGACTGTGTCGCCATGGCCGCCATC
CTGAGCACGCGGAGTCCGTTCGTGACGCCTCCGCCCGAGAGACGTGATGCCGCTCGCGAGGCCAGGATGGCCTTT
GATCGTGGCGACGGGGACGTCCTCACCGATCTAGCCGCGCTCGAGGCCTGGGAAGAGGAGAGCCGGAGACGGCCG
GGGGGTCGTCAGATGCGCGTCTTTTGCGACGACAACTTCTTGTCAATGCAGGCGCTCAACGACATTGTGGCCACG
CGGACGCAGCTGTACACGGCCCTGGCCGAGATGGGACTCGGGAGGGACACGGACGACAGCCGGGATCGGGACACG
CAGCTGCTCCGGAGCCTGGTGGCGGCGGCCTTTGCTCCACAGGTGGCCCGGATCCAATACCCGGACCGCAAGTAC
GCCAGCGGCATGTCGGGCGCCATCGAGCTGGACCCAGAGGCGAGGGCTATCAAGTACTACACGCAGGAGAGCGGA
CGCGTCTTCGTCCACCCGGCCAGCACCCTCTTCGGGAGCCAGGCATTCACGGGGGACGCAGCGTACGTGTCCTAC
TTTGGCATCATGGCGACGACCAAGGTCTTTATCCGCGACCTGACGCCCCTCAACGCCTACGGCCTCCTGCTCTTC
TGCGGCGCCATCGAGCTGGACACGCTGGGGAGGGGTCTGGTGGTGGACGGTTGGATACGGCTTCGCGGCTGGGCT
CGTATCGGGGAGGGTTGA
Gene >Ophun1|7088
ATGGTCAAAAAGGCCAAAGACAAGAGCGAAAAGGCGACGACTGCATCGGCAGGCCCGTCAGGCGCGCCCAACGGC
TCCAAGGATGGCGGCAAGGGCAAAAAGGGCCAGAAGAAGACGGAGCCCGTGGCAGCACCAGCCCCGGCACCGGCA
GCACCCCCGAAGCCGACAGTCAAGCAAATCATCGGAGGCTCGTCATGGACCGGAAAGCTGCCTGTCAACCTGCTG
AGCGAGCACTGTCAGAGGCAGCGGTGGGAGAAGCCCGAGTACGACACGCGCAGGACGGCCGAAGGCTTCTCGGTT
TGGGTGACGCTGAGCGGGCGAGACGCCAAGACGCAGCAGCTCACGCGGCTGGAGCCCTTCAAGATCCCGGCTAGT
CACAAGCACCTTTTGGTGAGGCAGACGGCGCTGGAGGCCAAGCACGCGGCGGCGACGTACGCGCTGTTCCGGGTT
TGCAACATGCAGAACAAGCACACGGTGCTTCCGCCGGATCACAAGTCGCTGTGGAAGGAGTTCCAGGCGCTCAAG
GCGCAGGACGTCAAGGAGGGCAAGGCGTGGATGTACGAGGCCGACCCGTTCAAGACGCTGCTGGAGCGGCAGGAG
AACAAGGCGGCGGCGGAGAAGAAGAGGACGGAGATGGAGGCGGCCAGGGCAAAGGCAAAGGAGATGCCGGGGGCT
TCGGGCTTGGTTCTGCTCAACAGCGCGGGAGCCGCGGGCGGCAACGCCATGAAGGGCTGGATGACGGCGCCCAAG
GTCGAGATGGGCAGGCAGACGAGGTTGCAGCTCGAGGCGCTCCTGCGAAAGGGCATCTCGTGGAATCCCAACGGC
ATCCGCATGAGTCGGGCGCAGAGGGATGGTGTCGTCGACGACCTGACCAAGATTGGCTTCCGACGCAGCCACGTG
GCTGAAGCGGCGGAATACTGCAAGGACCGCGAGGAGACGCTCGAATGGCTGCTCATCCACGTTCCCGAAGACGAT
CTGCCGCGATGGGCCTTTCCGGAGAAATACGCGGCCGGAGTTTCGGTGGGCGCGACCAATCTGAGGCGGGAGGGC
ATCGTCAAGTCGCTGTCGGAGACGGGGTACGCGCCTGAGCTGTGTGCGCGAGCCTTTGACGATAACGACGGCGAC
GAGGTCCGGGCGGCGGAGGCGCTGCAGGCGATGCTCTTCCCGCCGGCTCCCACGTCGGGCGAAGACTTCCTGAAC
ATGGGGGAGCCCGACGAGCAGTGGGCGGAAGAGGTGGCGAGCCTGGAGGCCATGTACGGTGATGGTCTAGTACGC
GAGGACGAGCAGACGATCCGGGTGCGGCTGGAGGCGGTACGTGACGCGCAGGACTCTCACAAGGGCGAGGTTGAG
GCGCATCTGCGGATCCGGCGATCGTCGACGTATCCCGAGCACCTGATATTGGGCGTCGTCGGCAAGCTACCGTCG
TACATGAAGCTCAGCATCGTCCGGAAGGCATTGGAGTACTCGGACGAGTCGCTGCGAGACGAGCCCCTGAAGATG
TACCTGGTGACGGATTGGGTGCAGCAGAATATCAACGGCATCATCGATGACCCGGGAAAGCTCGTCGACATCTCG
GCTGTGGCTTCGGCCGCGTGCGATGGTCGGCCAAAGGAGGCGTCGCAGGCCAAGGCGATCAACTCGACCAAGACG
CGGGGCCCGGCTCGGAGGACCATCTCGTGGACGGCGGACGCGCGGAGCAGAGAGGACTGGCTCAAGCGGCAGCAG
CGGCCGTGCTGGAGAGAGATGGAGGCCAAGCGGCGTCGGCTGCCGGCGTGGCGGATGAACGACTGCATCGTTCGG
ACGGTGGAAGAGCACGATGTGACCATCATCAGTGGCGAGACGGGCTCAGGCAAGTCGACGCAGTCGGTGCAGTTC
ATCCTCGACGATCTCTACGAGCGTGGCCTCGGCGAGCAGGCCAACATGCTGGTGACGCAGCCGCGACGCATCTCG
GCGTTGGGGTTGGCGGACCGAGTGGCGGAGGAGCGATGCTCGCGGGTGGGCGAAGAAGTCGGTTATGCCATCCGT
GGCGAGGCTCGACGATCGGAGCGGACGCGAATCACGTTTATGACGACGGGCGTGCTGCTGAGGCGACTGCAGACG
TCTGGTGGACGGATGGAGGACGTGGCGGCGTCTCTGGCGGACGCGAGTCACGTCGTCATCGATGAGGTTCACGAG
AGGAGTCTCGATACCGACTTCTTACTGACGCTGTTGCGTGAGGTGCTGAGAGGAGGAGGCGGGCCGAAGCTGATT
CTCATGTCGGCCACGCTGGATGCCGCCTCGTTCCGGCATTACTTTGCGTCCGAGGGCCTGACGGTCGGGCTGGTG
GAGATTGCTGGCAGGACGTTTCCGGTCGACGAGTTTTACCTGGACGATGTGCTGAGGATGAACTCGTACGCGCCG
GACTGGGAGCCGGACTCGGAGACTTCGGCTGTCGGACGGACGATGAAGCGGCTGGCCCAGCGGATGGACTATGAC
CTGCTGGCCGAGACGGTGCGGTCCATCGATCGGCAGCTCAGCGCCGAGAAGCAGACGGGTGCCATCCTCGTCTTC
CTGGCGGGCGTGGCCGAGATCAGCCAGGCCTGTGGACGGCTGCGGGCGACGAGCTCACTCCAGGTGTTTCCCCTT
CACGGATCTCTCGAGACTGGCGAGCAGAGACGAGTCTTTGGCCGGCCAGCCCCGGGCAAGCGAAAGGTGGTGGTG
GCAACCAACGTGGCGGAGACTTCCATCACCATCGATGACGTCGTCGTCGTCATTGACAGCGGCAAGGTCAAGGAG
ACGAGCCTCGACGCGACCAATAACAACATGCGCCGGCTGGAGGAGCGCTGGGCGTCTCGGGCCGCGTGCGAGCAG
AGGCGCGGACGGGCGGGACGCGTCTGCGAAGGCCGCTGCTACCGGCTGTACACGCGACAGACGGAGCAGCAGATG
GCTCCGCGGCCCGAGCCCGAGATGCGTCGGGTGCCGCTGGAGCAGCTGTGTCTGTCGGTGCGGGCCATGGGCTTC
CGTGACGTCGCCGGCTTCCTCGACCGGTGTCCTACGGCGCCGTCCGGGCCGGCTGTTGATGCCGCCTTGCGTCTG
CTGGGCCGGATGGGCGCTCTCGACGGCTCGGAGCTGACGGTGTTGGGACGCCAGCTGGCCAATCTACCGGCCGAT
CTGCGCTGCGGGAAGCTGATGATCCTAGGCGGACTGCTGGGCTGTCTACACGACTGTGTCGCCATGGCCGCCATC
CTGAGCACGCGGAGTCCGTTCGTGACGCCTCCGCCCGAGAGACGTGATGCCGCTCGCGAGGCCAGGATGGCCTTT
GATCGTGGCGACGGGGACGTCCTCACCGATCTAGCCGCGCTCGAGGCCTGGGAAGAGGAGAGCCGGAGACGGCCG
GGGGGTCGTCAGATGCGCGTCTTTTGCGACGACAACTTCTTGTCAATGCAGGCGCTCAACGACATTGTGGCCACG
CGGACGCAGCTGTACACGGCCCTGGCCGAGATGGGACTCGGGAGGGACACGGACGACAGCCGGGATCGGGACACG
CAGCTGCTCCGGAGCCTGGTGGCGGCGGCCTTTGCTCCACAGGTGGCCCGGATCCAATACCCGGACCGCAAGTAC
GCCAGCGGCATGTCGGGCGCCATCGAGCTGGACCCAGAGGCGAGGGCTATCAAGTACTACACGCAGGAGAGCGGA
CGCGTCTTCGTCCACCCGGCCAGCACCCTCTTCGGGAGCCAGGCATTCACGGGGGACGCAGCGTACGTGTCCTAC
TTTGGCATCATGGCGACGACCAAGGTCTTTATCCGCGACCTGACGCCCCTCAACGCCTACGGCCTCCTGCTCTTC
TGCGGCGCCATCGAGCTGGACACGCTGGGGAGGGGTCTGGTGGTGGACGGTTGGATACGGCTTCGCGGCTGGGCT
CGTATCGGGGTGCTGGTTGCGAGGCTGCGAGGGTTGCTTGATGGGTTGCTGGCCAGGAGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail