Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7084
Gene name
LocationContig_844:105..5364
Strand+
Gene length (bp)5259
Transcript length (bp)4728
Coding sequence length (bp)4728
Protein length (aa) 1576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13832 zf-HC5HC2H_2 PHD-zinc-finger like domain 9.7E-21 1028 1120
PF13771 zf-HC5HC2H PHD-like zinc-binding domain 8.6E-17 1038 1142
PF01426 BAH BAH domain 2.8E-13 192 296
PF13831 PHD_2 PHD-finger 1.2E-07 920 950

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 187 1111 2.0E-67
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 192 793 1.0E-63
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 1028 1144 2.0E-18
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 906 1109 9.0E-18
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 1028 1144 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10077|SNT2_SCHPO Lid2 complex component snt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snt2 PE=3 SV=1 187 1111 2.0E-67
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 192 793 1.0E-63
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 1028 1144 2.0E-18
sp|P53127|SNT2_YEAST E3 ubiquitin-protein ligase SNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT2 PE=1 SV=1 906 1109 9.0E-18
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 1028 1144 3.0E-17
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 1028 1144 8.0E-17
sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 1028 1144 1.0E-14
sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=2 1028 1105 1.0E-13
sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 1028 1105 1.0E-13
sp|P55198|AF17_HUMAN Protein AF-17 OS=Homo sapiens GN=MLLT6 PE=1 SV=2 1028 1113 6.0E-13
sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=jade1 PE=2 SV=1 1036 1121 1.0E-12
sp|Q7YZH1|RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster GN=rno PE=1 SV=1 1036 1103 2.0E-12
sp|Q9C5X4|ATX1_ARATH Histone-lysine N-methyltransferase ATX1 OS=Arabidopsis thaliana GN=ATX1 PE=1 SV=2 1028 1147 5.0E-12
sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=jade1 PE=2 SV=1 1036 1103 9.0E-12
sp|P34447|YM2A_CAEEL Uncharacterized protein F54F2.2, isoform a OS=Caenorhabditis elegans GN=F54F2.2/F54F2.3/F54F2.4 PE=3 SV=2 1028 1105 1.0E-11
sp|P0CB22|ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana GN=ATX2 PE=2 SV=1 1028 1145 2.0E-11
sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=JADE1 PE=1 SV=1 1036 1103 3.0E-11
sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Jade1 PE=1 SV=2 1036 1103 3.0E-11
sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=JADE1 PE=2 SV=1 1036 1103 4.0E-11
sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1 1032 1104 9.0E-11
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=3 1036 1104 1.0E-10
sp|Q7ZVP1|JADE3_DANRE Protein Jade-3 OS=Danio rerio GN=jade3 PE=2 SV=1 1032 1099 2.0E-10
sp|Q6ZQF7|JADE2_MOUSE Protein Jade-2 OS=Mus musculus GN=Jade2 PE=1 SV=2 1034 1103 3.0E-10
sp|Q9NQC1|JADE2_HUMAN Protein Jade-2 OS=Homo sapiens GN=JADE2 PE=1 SV=2 1034 1103 4.0E-10
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=2 1036 1104 4.0E-10
sp|O74759|NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nto1 PE=1 SV=1 1031 1105 9.0E-10
sp|Q20318|LIN49_CAEEL Protein lin-49 OS=Caenorhabditis elegans GN=lin-49 PE=1 SV=1 1028 1151 1.0E-09
sp|Q6IE82|JADE3_MOUSE Protein Jade-3 OS=Mus musculus GN=Jade3 PE=1 SV=1 1036 1103 2.0E-09
sp|Q92613|JADE3_HUMAN Protein Jade-3 OS=Homo sapiens GN=JADE3 PE=1 SV=1 1036 1103 2.0E-09
sp|Q91VY5|KDM4B_MOUSE Lysine-specific demethylase 4B OS=Mus musculus GN=Kdm4b PE=2 SV=1 1028 1106 1.0E-08
sp|Q0P4S5|JADE3_XENTR Protein Jade-3 OS=Xenopus tropicalis GN=jade3 PE=2 SV=1 1036 1099 2.0E-08
sp|Q29EQ3|RNO_DROPS PHD finger protein rhinoceros OS=Drosophila pseudoobscura pseudoobscura GN=rno PE=3 SV=2 1036 1089 3.0E-08
sp|O94953|KDM4B_HUMAN Lysine-specific demethylase 4B OS=Homo sapiens GN=KDM4B PE=1 SV=4 1028 1106 8.0E-08
sp|O94776|MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens GN=MTA2 PE=1 SV=1 604 790 9.0E-08
sp|Q80TZ9|RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus GN=Rere PE=1 SV=3 604 790 1.0E-07
sp|Q62901|RERE_RAT Arginine-glutamic acid dipeptide repeats protein OS=Rattus norvegicus GN=Rere PE=1 SV=2 604 790 1.0E-07
sp|Q9R190|MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus GN=Mta2 PE=1 SV=1 604 790 1.0E-07
sp|Q8K4B0|MTA1_MOUSE Metastasis-associated protein MTA1 OS=Mus musculus GN=Mta1 PE=1 SV=1 604 790 2.0E-07
sp|Q62599|MTA1_RAT Metastasis-associated protein MTA1 OS=Rattus norvegicus GN=Mta1 PE=1 SV=1 604 790 2.0E-07
sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens GN=MTA1 PE=1 SV=2 604 790 2.0E-07
sp|Q9P2R6|RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens GN=RERE PE=1 SV=2 604 790 2.0E-07
sp|Q9BTC8|MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens GN=MTA3 PE=1 SV=2 604 684 2.0E-07
sp|A6QL72|MTA3_BOVIN Metastasis-associated protein MTA3 OS=Bos taurus GN=MTA3 PE=2 SV=1 604 684 9.0E-07
sp|Q8VCD7|KDM4C_MOUSE Lysine-specific demethylase 4C OS=Mus musculus GN=Kdm4c PE=1 SV=1 1028 1106 2.0E-06
sp|Q9H3R0|KDM4C_HUMAN Lysine-specific demethylase 4C OS=Homo sapiens GN=KDM4C PE=1 SV=2 1028 1106 3.0E-06
sp|Q9P2K3|RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens GN=RCOR3 PE=1 SV=2 544 730 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003682 chromatin binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7084
MTDSPRDQASKEPEPESTTATAKDGSSSSQHGTRSSRKTARPNYAEDKDIDQDNYDFYRETKRPGRHAASGPDRG
GGRRSTGGDSRMSETDGQDGGGSCGSGTGGGGAPPGSAAAVSHMSRKRKAAKRAGNAAQTPAATTAPLRDTNMMT
FEQSSSRPDQGRMTADDGTVLEPNGQSSSGPSANLADAVLPDHVYLVCEPPGEPYYLGRIMEFLHAQNDSARCVE
AVRINWFYRPKDIGRKPLDTRQVYATMHSDISPLTALRGKCHIKHRCEIDNFDQFRKTPDSFWFDKLYDRYIQKN
YDLIQTASIVNVPDKVKKMLDERWKFVLVEQGRGKELTSAVKLCKRCSGYCASNDSVDCAVCHNTYHMNCVRPPL
LKKPSRGFAWSCAACSRAQERKLEARDTPNGADSGAPAEDEEFPDDEDDEGQGIATDRTTPAEDAPNHQGTAEQV
YRASLWPWRYLGMHCKPEDALDYDDRIYPRASTRIGPRHQANVGPWPGRPVQYVKPIETKKGSKGQKMNKEAQDA
EKAAKGKRPKWVQDQPPGYVARGEDYDDGDPRATATLLWKPPPPDSISVKTMKEYDDETQAMAKKLGLPPRSTNL
RDAAVETLFRHDYDVSEALRAVPEIQREAFKEPNPSATEHKKFEEAVSKYGSELHQVKKHVKTMTHGAVVRFYYT
WKKTDRGQQLWGSFSGRKGKKQAKRAEAAANKFADDVADNDDDSAFDPGKAAEKKRSFVCQFCSTTSSRQWRRAP
NIAPGVPSDQGARSSGKDKSGGQCVVALCRRCAELWRRYGVRYEEMDEGGKKAAQSGGRASKRKQDEELLKQQQA
AQEVSLTTPDRDNTPQSVPAPAVSQEPPRKKLKGAPSDREPEQACSDGGGSGSTPSLPKKKEKAADATPVPEMPK
PRTLPCAICHQLEPQGDQHLSCRECRLTVHRNCYGIMDNRIQGKWICDMCSNDKSPQVSIQYKCVLCPVEHTEWD
FVEQPKLTHHKKKMSEKDRGREKMEVQQARKAAEFYRKKQEEMNRPVNPREPLKRTADNNWVHVTCAVWTPEVKF
GNAKALEPSEGIPSIPRSRYDETCQACSQKGGACIFCHQCRVPYHVECARQQGHLLGFDVTPVKSSRRDQFNIVT
VNGESGTMSAVMWCKDHVPTKTMAHRMDETAGDSGLNALQLYVQNYKQADLTLTGTVRKANLMMNAAKTSSAPPV
QVPRRTSASGGPPGTVNGRARSNEATESASCNPQQAGEKVCITCGVDVTPKWWPIDDSLGRRLTNGHHGAIGSEA
QKFVEQRRFQCHKCRKAACPPMPYSSPPRYRDATSNGGQGARVSPPVDYRHELHALLHHPASHGPPALPPAPTLA
PPPPAVPPSGGPPPAPMAVAAPHHGPTHVMGPRPTTAVSLPFVAAPPSRHGHYNEWSHQQPPGPRHGSPARHLNG
GPPPLHGGPPPGPPPPPAMSSLSSLRPPAMSGPPPPMAHHHPPMYGSGMPVSPRRMSGPTHPAAYVPPYHGPAAH
GASPRLSNGVPPPPRTETFSHGLHPQRSPYSGSPPLPRSGLQPGPHENGSKVESSQANKPASGASASPSLRNLLS
*
Coding >Ophun1|7084
ATGACTGACTCACCACGCGACCAGGCCTCCAAGGAGCCCGAGCCCGAGTCGACCACAGCCACGGCCAAGGACGGG
TCGTCGTCGTCGCAACACGGGACTCGGTCGTCGCGCAAGACTGCGCGCCCCAATTATGCAGAGGACAAGGACATT
GACCAGGATAATTACGACTTCTACCGCGAAACAAAGCGTCCGGGCCGGCACGCGGCTTCCGGACCCGACCGCGGA
GGAGGGCGCAGGTCGACCGGGGGCGACTCGAGGATGAGTGAAACCGACGGCCAGGACGGCGGCGGTTCCTGTGGG
AGCGGGACCGGCGGCGGCGGCGCTCCTCCTGGCTCCGCAGCGGCTGTGTCGCACATGTCGCGCAAACGCAAGGCG
GCCAAGCGGGCTGGAAATGCGGCGCAGACGCCGGCGGCCACGACGGCGCCGTTGCGAGACACCAACATGATGACC
TTTGAGCAGTCCAGCTCGCGCCCGGACCAGGGGCGCATGACGGCTGACGACGGTACCGTGCTAGAGCCGAATGGT
CAGTCTTCGTCCGGCCCCAGCGCAAACCTTGCTGACGCTGTGCTGCCAGATCACGTCTACCTGGTGTGCGAGCCG
CCCGGAGAGCCCTATTACCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGATAGCGCCCGCTGCGTCGAG
GCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGACGCAAGCCCCTCGACACCCGCCAGGTCTATGCC
ACGATGCATTCCGACATTAGTCCCCTGACGGCCCTGCGCGGCAAATGCCACATCAAGCACCGCTGTGAGATTGAC
AACTTTGACCAGTTCCGCAAGACGCCCGACTCGTTCTGGTTTGACAAGTTGTACGACCGCTACATTCAAAAGAAC
TACGACCTGATCCAGACGGCCAGCATCGTCAACGTCCCGGACAAGGTTAAGAAGATGCTCGACGAGCGCTGGAAG
TTTGTCTTGGTGGAGCAGGGCCGTGGCAAGGAGCTTACGAGCGCCGTTAAGCTCTGCAAGAGGTGCAGCGGCTAC
TGTGCGAGCAACGATTCGGTCGACTGTGCGGTCTGCCACAACACCTATCACATGAACTGCGTCAGGCCTCCCCTG
TTGAAAAAGCCCTCACGAGGCTTCGCCTGGTCCTGCGCCGCCTGCAGCAGGGCCCAGGAACGCAAGCTCGAGGCT
CGCGACACTCCCAACGGTGCCGACTCTGGCGCCCCGGCCGAGGACGAAGAGTTTCCCGACGATGAGGACGACGAG
GGCCAGGGCATCGCCACCGACCGCACCACCCCCGCCGAAGACGCACCCAATCACCAGGGAACCGCCGAGCAAGTC
TACCGCGCCAGCCTGTGGCCCTGGCGCTACCTGGGCATGCACTGCAAGCCCGAAGACGCCCTCGACTACGACGAC
CGCATCTATCCCCGTGCCAGCACCCGCATCGGTCCCCGCCACCAGGCCAACGTCGGCCCCTGGCCGGGCCGTCCG
GTGCAGTATGTGAAGCCGATTGAGACGAAAAAGGGCTCCAAGGGTCAGAAGATGAACAAGGAGGCCCAGGACGCG
GAAAAGGCCGCCAAGGGCAAGCGGCCCAAATGGGTCCAGGACCAGCCTCCCGGCTACGTCGCCCGCGGGGAGGAC
TATGATGATGGCGACCCCAGGGCCACGGCGACGCTTCTATGGAAGCCTCCGCCGCCCGACAGCATTTCGGTCAAG
ACGATGAAGGAGTACGACGACGAGACGCAGGCCATGGCCAAGAAGCTCGGCCTCCCGCCCCGTTCGACGAATCTC
CGAGACGCGGCGGTGGAGACGCTGTTCCGTCACGACTACGACGTTTCCGAGGCTCTCAGGGCCGTTCCGGAGATC
CAGCGGGAGGCCTTCAAAGAGCCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCCGTATCCAAGTAC
GGGTCCGAGCTGCACCAGGTCAAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGCTTCTATTACACC
TGGAAGAAGACGGATCGTGGTCAGCAGCTCTGGGGCAGCTTCTCTGGACGTAAGGGCAAGAAGCAGGCCAAGAGG
GCTGAAGCAGCCGCCAACAAGTTCGCCGACGACGTGGCGGACAACGACGACGACTCGGCCTTTGACCCGGGTAAG
GCGGCCGAGAAGAAGCGCAGCTTCGTATGCCAATTCTGCTCCACGACGTCGTCTCGTCAGTGGCGGCGGGCGCCC
AACATAGCACCGGGCGTCCCTAGCGATCAGGGAGCCCGATCCAGCGGCAAGGACAAGAGCGGCGGACAGTGCGTC
GTGGCTCTCTGCCGGAGGTGCGCTGAGCTGTGGCGGCGCTACGGCGTCCGGTACGAGGAGATGGACGAGGGCGGC
AAAAAGGCGGCCCAGTCCGGCGGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAGCAGCAGCAGGCC
GCCCAGGAGGTGAGCCTGACGACGCCGGACCGCGACAACACGCCCCAGAGCGTCCCCGCGCCGGCCGTCAGCCAG
GAACCGCCGCGGAAGAAGCTTAAGGGAGCTCCCTCGGATAGGGAGCCGGAACAGGCGTGTTCAGACGGAGGTGGC
AGCGGATCGACGCCCAGCCTTCCTAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTCCCGGAGATGCCGAAG
CCGCGAACGCTTCCATGCGCCATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCTTGTCGAGAGTGC
CGGCTGACGGTGCACCGCAACTGCTACGGTATCATGGACAACCGCATTCAGGGGAAATGGATCTGCGACATGTGC
TCCAACGACAAGAGCCCGCAGGTTTCTATCCAATACAAATGCGTCCTCTGTCCTGTCGAGCACACTGAATGGGAC
TTTGTCGAGCAGCCCAAGCTCACTCACCACAAGAAGAAGATGTCAGAAAAGGACCGGGGGCGGGAGAAGATGGAG
GTGCAGCAGGCCCGCAAGGCTGCCGAGTTCTACCGCAAGAAGCAGGAGGAGATGAACCGGCCGGTGAACCCGAGA
GAGCCCCTGAAGCGGACGGCCGACAACAACTGGGTGCACGTTACGTGCGCCGTCTGGACGCCCGAGGTCAAGTTT
GGCAACGCAAAGGCGCTGGAGCCGTCAGAGGGGATACCGTCGATCCCGAGGTCGAGATACGACGAGACGTGCCAG
GCTTGCAGCCAGAAGGGCGGCGCGTGCATCTTTTGCCACCAGTGCCGCGTTCCGTATCACGTCGAGTGTGCGCGT
CAACAGGGTCACCTGCTCGGGTTCGACGTTACGCCGGTTAAGAGCTCGCGTCGAGACCAGTTCAACATCGTGACG
GTCAACGGAGAGAGCGGCACCATGTCGGCCGTCATGTGGTGCAAGGACCACGTGCCGACCAAGACGATGGCGCAC
CGGATGGACGAGACGGCTGGCGATTCCGGCCTGAACGCGCTGCAGCTCTACGTGCAGAATTACAAGCAGGCGGAC
CTGACGCTGACTGGCACCGTTCGCAAGGCCAACCTGATGATGAACGCGGCCAAGACGTCGTCGGCGCCCCCCGTC
CAGGTGCCTCGGCGGACGTCTGCCAGCGGAGGGCCCCCCGGAACCGTCAACGGACGGGCGCGCAGCAACGAGGCG
ACCGAATCGGCATCGTGCAACCCGCAGCAGGCGGGCGAGAAGGTGTGCATCACGTGTGGCGTCGACGTGACGCCC
AAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGGACACCACGGCGCTATCGGCTCCGAGGCG
CAGAAGTTTGTCGAGCAGCGGCGCTTCCAGTGTCACAAGTGCCGCAAGGCCGCCTGTCCTCCGATGCCGTACTCG
TCGCCCCCCCGTTATCGCGATGCCACCAGCAACGGCGGTCAGGGGGCCCGAGTGTCGCCGCCCGTCGACTACCGC
CACGAGCTCCACGCCTTGCTACACCATCCGGCCTCTCACGGTCCACCGGCCCTACCTCCGGCTCCGACGCTGGCT
CCTCCCCCTCCGGCGGTGCCTCCCAGCGGCGGGCCCCCTCCAGCCCCCATGGCCGTCGCGGCACCGCACCATGGA
CCGACACACGTCATGGGACCGAGGCCGACCACGGCCGTGTCTCTGCCGTTCGTGGCCGCGCCGCCTTCCCGGCAC
GGACACTACAACGAATGGAGCCATCAGCAGCCGCCGGGGCCCAGGCACGGGTCGCCGGCGCGCCACCTCAACGGG
GGACCGCCGCCGCTGCATGGCGGACCTCCTCCCGGTCCGCCGCCTCCACCGGCCATGTCGAGCCTCTCATCGCTC
CGACCGCCGGCCATGTCGGGGCCGCCTCCCCCCATGGCTCACCATCACCCGCCCATGTACGGCAGCGGCATGCCC
GTGTCTCCCCGACGGATGAGCGGGCCCACGCACCCGGCAGCATACGTTCCTCCGTACCACGGACCGGCGGCTCAC
GGCGCGTCGCCGAGGCTGAGCAACGGAGTGCCGCCGCCCCCGCGAACGGAGACGTTCTCGCACGGGCTGCACCCG
CAGCGGTCGCCGTACTCGGGGAGCCCGCCGCTGCCTCGGAGCGGACTGCAGCCGGGACCTCACGAGAACGGAAGC
AAGGTGGAGAGCTCGCAGGCAAACAAGCCGGCCAGCGGGGCCAGTGCGAGCCCGTCGCTGCGCAATCTGCTGTCG
TGA
Transcript >Ophun1|7084
ATGACTGACTCACCACGCGACCAGGCCTCCAAGGAGCCCGAGCCCGAGTCGACCACAGCCACGGCCAAGGACGGG
TCGTCGTCGTCGCAACACGGGACTCGGTCGTCGCGCAAGACTGCGCGCCCCAATTATGCAGAGGACAAGGACATT
GACCAGGATAATTACGACTTCTACCGCGAAACAAAGCGTCCGGGCCGGCACGCGGCTTCCGGACCCGACCGCGGA
GGAGGGCGCAGGTCGACCGGGGGCGACTCGAGGATGAGTGAAACCGACGGCCAGGACGGCGGCGGTTCCTGTGGG
AGCGGGACCGGCGGCGGCGGCGCTCCTCCTGGCTCCGCAGCGGCTGTGTCGCACATGTCGCGCAAACGCAAGGCG
GCCAAGCGGGCTGGAAATGCGGCGCAGACGCCGGCGGCCACGACGGCGCCGTTGCGAGACACCAACATGATGACC
TTTGAGCAGTCCAGCTCGCGCCCGGACCAGGGGCGCATGACGGCTGACGACGGTACCGTGCTAGAGCCGAATGGT
CAGTCTTCGTCCGGCCCCAGCGCAAACCTTGCTGACGCTGTGCTGCCAGATCACGTCTACCTGGTGTGCGAGCCG
CCCGGAGAGCCCTATTACCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGATAGCGCCCGCTGCGTCGAG
GCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGACGCAAGCCCCTCGACACCCGCCAGGTCTATGCC
ACGATGCATTCCGACATTAGTCCCCTGACGGCCCTGCGCGGCAAATGCCACATCAAGCACCGCTGTGAGATTGAC
AACTTTGACCAGTTCCGCAAGACGCCCGACTCGTTCTGGTTTGACAAGTTGTACGACCGCTACATTCAAAAGAAC
TACGACCTGATCCAGACGGCCAGCATCGTCAACGTCCCGGACAAGGTTAAGAAGATGCTCGACGAGCGCTGGAAG
TTTGTCTTGGTGGAGCAGGGCCGTGGCAAGGAGCTTACGAGCGCCGTTAAGCTCTGCAAGAGGTGCAGCGGCTAC
TGTGCGAGCAACGATTCGGTCGACTGTGCGGTCTGCCACAACACCTATCACATGAACTGCGTCAGGCCTCCCCTG
TTGAAAAAGCCCTCACGAGGCTTCGCCTGGTCCTGCGCCGCCTGCAGCAGGGCCCAGGAACGCAAGCTCGAGGCT
CGCGACACTCCCAACGGTGCCGACTCTGGCGCCCCGGCCGAGGACGAAGAGTTTCCCGACGATGAGGACGACGAG
GGCCAGGGCATCGCCACCGACCGCACCACCCCCGCCGAAGACGCACCCAATCACCAGGGAACCGCCGAGCAAGTC
TACCGCGCCAGCCTGTGGCCCTGGCGCTACCTGGGCATGCACTGCAAGCCCGAAGACGCCCTCGACTACGACGAC
CGCATCTATCCCCGTGCCAGCACCCGCATCGGTCCCCGCCACCAGGCCAACGTCGGCCCCTGGCCGGGCCGTCCG
GTGCAGTATGTGAAGCCGATTGAGACGAAAAAGGGCTCCAAGGGTCAGAAGATGAACAAGGAGGCCCAGGACGCG
GAAAAGGCCGCCAAGGGCAAGCGGCCCAAATGGGTCCAGGACCAGCCTCCCGGCTACGTCGCCCGCGGGGAGGAC
TATGATGATGGCGACCCCAGGGCCACGGCGACGCTTCTATGGAAGCCTCCGCCGCCCGACAGCATTTCGGTCAAG
ACGATGAAGGAGTACGACGACGAGACGCAGGCCATGGCCAAGAAGCTCGGCCTCCCGCCCCGTTCGACGAATCTC
CGAGACGCGGCGGTGGAGACGCTGTTCCGTCACGACTACGACGTTTCCGAGGCTCTCAGGGCCGTTCCGGAGATC
CAGCGGGAGGCCTTCAAAGAGCCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCCGTATCCAAGTAC
GGGTCCGAGCTGCACCAGGTCAAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGCTTCTATTACACC
TGGAAGAAGACGGATCGTGGTCAGCAGCTCTGGGGCAGCTTCTCTGGACGTAAGGGCAAGAAGCAGGCCAAGAGG
GCTGAAGCAGCCGCCAACAAGTTCGCCGACGACGTGGCGGACAACGACGACGACTCGGCCTTTGACCCGGGTAAG
GCGGCCGAGAAGAAGCGCAGCTTCGTATGCCAATTCTGCTCCACGACGTCGTCTCGTCAGTGGCGGCGGGCGCCC
AACATAGCACCGGGCGTCCCTAGCGATCAGGGAGCCCGATCCAGCGGCAAGGACAAGAGCGGCGGACAGTGCGTC
GTGGCTCTCTGCCGGAGGTGCGCTGAGCTGTGGCGGCGCTACGGCGTCCGGTACGAGGAGATGGACGAGGGCGGC
AAAAAGGCGGCCCAGTCCGGCGGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAGCAGCAGCAGGCC
GCCCAGGAGGTGAGCCTGACGACGCCGGACCGCGACAACACGCCCCAGAGCGTCCCCGCGCCGGCCGTCAGCCAG
GAACCGCCGCGGAAGAAGCTTAAGGGAGCTCCCTCGGATAGGGAGCCGGAACAGGCGTGTTCAGACGGAGGTGGC
AGCGGATCGACGCCCAGCCTTCCTAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTCCCGGAGATGCCGAAG
CCGCGAACGCTTCCATGCGCCATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCTTGTCGAGAGTGC
CGGCTGACGGTGCACCGCAACTGCTACGGTATCATGGACAACCGCATTCAGGGGAAATGGATCTGCGACATGTGC
TCCAACGACAAGAGCCCGCAGGTTTCTATCCAATACAAATGCGTCCTCTGTCCTGTCGAGCACACTGAATGGGAC
TTTGTCGAGCAGCCCAAGCTCACTCACCACAAGAAGAAGATGTCAGAAAAGGACCGGGGGCGGGAGAAGATGGAG
GTGCAGCAGGCCCGCAAGGCTGCCGAGTTCTACCGCAAGAAGCAGGAGGAGATGAACCGGCCGGTGAACCCGAGA
GAGCCCCTGAAGCGGACGGCCGACAACAACTGGGTGCACGTTACGTGCGCCGTCTGGACGCCCGAGGTCAAGTTT
GGCAACGCAAAGGCGCTGGAGCCGTCAGAGGGGATACCGTCGATCCCGAGGTCGAGATACGACGAGACGTGCCAG
GCTTGCAGCCAGAAGGGCGGCGCGTGCATCTTTTGCCACCAGTGCCGCGTTCCGTATCACGTCGAGTGTGCGCGT
CAACAGGGTCACCTGCTCGGGTTCGACGTTACGCCGGTTAAGAGCTCGCGTCGAGACCAGTTCAACATCGTGACG
GTCAACGGAGAGAGCGGCACCATGTCGGCCGTCATGTGGTGCAAGGACCACGTGCCGACCAAGACGATGGCGCAC
CGGATGGACGAGACGGCTGGCGATTCCGGCCTGAACGCGCTGCAGCTCTACGTGCAGAATTACAAGCAGGCGGAC
CTGACGCTGACTGGCACCGTTCGCAAGGCCAACCTGATGATGAACGCGGCCAAGACGTCGTCGGCGCCCCCCGTC
CAGGTGCCTCGGCGGACGTCTGCCAGCGGAGGGCCCCCCGGAACCGTCAACGGACGGGCGCGCAGCAACGAGGCG
ACCGAATCGGCATCGTGCAACCCGCAGCAGGCGGGCGAGAAGGTGTGCATCACGTGTGGCGTCGACGTGACGCCC
AAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGGACACCACGGCGCTATCGGCTCCGAGGCG
CAGAAGTTTGTCGAGCAGCGGCGCTTCCAGTGTCACAAGTGCCGCAAGGCCGCCTGTCCTCCGATGCCGTACTCG
TCGCCCCCCCGTTATCGCGATGCCACCAGCAACGGCGGTCAGGGGGCCCGAGTGTCGCCGCCCGTCGACTACCGC
CACGAGCTCCACGCCTTGCTACACCATCCGGCCTCTCACGGTCCACCGGCCCTACCTCCGGCTCCGACGCTGGCT
CCTCCCCCTCCGGCGGTGCCTCCCAGCGGCGGGCCCCCTCCAGCCCCCATGGCCGTCGCGGCACCGCACCATGGA
CCGACACACGTCATGGGACCGAGGCCGACCACGGCCGTGTCTCTGCCGTTCGTGGCCGCGCCGCCTTCCCGGCAC
GGACACTACAACGAATGGAGCCATCAGCAGCCGCCGGGGCCCAGGCACGGGTCGCCGGCGCGCCACCTCAACGGG
GGACCGCCGCCGCTGCATGGCGGACCTCCTCCCGGTCCGCCGCCTCCACCGGCCATGTCGAGCCTCTCATCGCTC
CGACCGCCGGCCATGTCGGGGCCGCCTCCCCCCATGGCTCACCATCACCCGCCCATGTACGGCAGCGGCATGCCC
GTGTCTCCCCGACGGATGAGCGGGCCCACGCACCCGGCAGCATACGTTCCTCCGTACCACGGACCGGCGGCTCAC
GGCGCGTCGCCGAGGCTGAGCAACGGAGTGCCGCCGCCCCCGCGAACGGAGACGTTCTCGCACGGGCTGCACCCG
CAGCGGTCGCCGTACTCGGGGAGCCCGCCGCTGCCTCGGAGCGGACTGCAGCCGGGACCTCACGAGAACGGAAGC
AAGGTGGAGAGCTCGCAGGCAAACAAGCCGGCCAGCGGGGCCAGTGCGAGCCCGTCGCTGCGCAATCTGCTGTCG
TGA
Gene >Ophun1|7084
ATGACTGACTCACCACGCGACCAGGCCTCCAAGGAGCCCGAGCCCGAGTCGACCACAGCCACGGCCAAGGACGGG
TCGTCGTCGTCGCAACACGGGACTCGGTCGTCGCGCAAGACTGCGCGCCCCAATTATGCAGAGGACAAGGACATT
GACCAGGATAATTACGACTTCTACCGCGAAACAAAGCGTCCGGGCCGGCACGCGGCTTCCGGACCCGACCGCGGA
GGAGGGCGCAGGTCGACCGGGGGCGACTCGAGGATGAGTGAAACCGACGGCCAGGACGGCGGCGGTTCCTGTGGG
AGCGGGACCGGCGGCGGCGGCGCTCCTCCTGGCTCCGCAGCGGCTGTGTCGCACATGTCGCGCAAACGCAAGGCG
GCCAAGCGGGCTGGAAATGCGGCGCAGACGCCGGCGGCCACGACGGCGCCGTTGCGAGACACCAACATGATGACC
TTTGAGCAGTCCAGCTCGCGCCCGGACCAGGGGCGCATGACGGCTGACGACGGTACCGTGCTAGAGCCGAATGGT
CAGTCTTCGTCCGGCCCCAGCGCAAACCTTGCTGACGCTGTGCTGCCAGATCACGTCTACCTGGTGTGCGAGCCG
CCCGGAGAGCCCTATTACCTTGGTCGCATCATGGAGTTTCTGCACGCCCAAAACGATAGCGCCCGCTGCGTCGAG
GCTGTCCGAATCAACTGGTTCTACCGGCCCAAGGACATTGGACGCAAGCCCCTCGACACCCGCCAGGTCTATGCC
ACGATGCATTCCGACATTAGTCCCCTGACGGCCCTGCGCGGCAAATGCCACATCAAGCACCGCTGTGAGATTGAC
AACTTTGACCAGTTCCGCAAGACGCCCGACTCGTTCTGGTTTGACAAGTTGTACGACCGCTACATTCAAAAGAAC
TACGACCTGATCCAGACGGCCAGCATCGTCAACGTCCCGGACAAGGTTAAGAAGATGCTCGACGAGCGCTGGAAG
TTTGTCTTGGTGGAGCAGGGCCGTGGCAAGGAGCTTACGAGCGCCGTTAAGCTCTGCAAGAGGTGCAGCGGCTAC
TGTGCGAGGTACGTCTTCTCAACAGCTCTCTCACCTGCATTTGCCTGTCCTCACCCGTCCTCACCTGCTCTCACC
TGCTCTCACCTCTTCTTCTCACCTCTTCTCACCTCTTCTCACCTCCACTCATCTATGTTTATCTGCTCTCATTGA
AAATCTCACCCCCTCTCATTTTCATTTCCTCCACGTCATTTTCTTCCCTTGCCAACTGTCCCCGATGCATCCCTC
TCACATATTCACACTGCCCGCCCCCCCCCCCTACTCTGTTACACGAGCAATCTGTGAGGGGTCGATTGAGTGTCA
GAGAGAGACATGAGGACTGGCAATGGCGAGAGAGAACGACAAGATGACATTGGCACATCACCTCTCACACTCGCA
CACATGCACAAACCTCTGCCGTCGTTGCTCAACCCGTCACACTAACATGTGTGCTTCACCAGCAACGATTCGGTC
GACTGTGCGGTCTGCCACAACACCTATCACATGAACTGCGTCAGGCCTCCCCTGTTGAAAAAGCCCTCACGAGGC
TTCGCCTGGTCCTGCGCCGCCTGCAGCAGGGCCCAGGAACGCAAGCTCGAGGCTCGCGACACTCCCAACGGTGCC
GACTCTGGCGCCCCGGCCGAGGACGAAGAGTTTCCCGACGATGAGGACGACGAGGGCCAGGGCATCGCCACCGAC
CGCACCACCCCCGCCGAAGACGCACCCAATCACCAGGGAACCGCCGAGCAAGTCTACCGCGCCAGCCTGTGGCCC
TGGCGCTACCTGGGCATGCACTGCAAGCCCGAAGACGCCCTCGACTACGACGACCGCATCTATCCCCGTGCCAGC
ACCCGCATCGGTCCCCGCCACCAGGCCAACGTCGGCCCCTGGCCGGGCCGTCCGGTGCAGTATGTGAAGCCGATT
GAGACGAAAAAGGGCTCCAAGGGTCAGAAGATGAACAAGGAGGCCCAGGACGCGGAAAAGGCCGCCAAGGGCAAG
CGGCCCAAATGGGTCCAGGACCAGCCTCCCGGCTACGTCGCCCGCGGGGAGGACTATGATGATGGCGACCCCAGG
GCCACGGCGACGCTTCTATGGAAGCCTCCGCCGCCCGACAGCATTTCGGTCAAGACGATGAAGGAGTACGACGAC
GAGACGCAGGCCATGGCCAAGAAGCTCGGCCTCCCGCCCCGTTCGACGAATCTCCGAGACGCGGCGGTGGAGACG
CTGTTCCGTCACGACTACGACGTTTCCGAGGCTCTCAGGGCCGTTCCGGAGATCCAGCGGGAGGCCTTCAAAGAG
CCGAACCCAAGCGCGACGGAGCACAAGAAGTTCGAAGAGGCCGTATCCAAGTACGGGTCCGAGCTGCACCAGGTC
AAGAAGCACGTCAAGACCATGACGCACGGCGCCGTCGTTCGCTTCTATTACACCTGGAAGAAGACGGATCGTGGT
CAGCAGCTCTGGGGCAGCTTCTCTGGACGTAAGGGCAAGAAGCAGGCCAAGAGGGCTGAAGCAGCCGCCAACAAG
TTCGCCGACGACGTGGCGGACAACGACGACGACTCGGCCTTTGACCCGGGTAAGGCGGCCGAGAAGAAGCGCAGC
TTCGTATGCCAATTCTGCTCCACGACGTCGTCTCGTCAGTGGCGGCGGGCGCCCAACATAGCACCGGGCGTCCCT
AGCGATCAGGGAGCCCGATCCAGCGGCAAGGACAAGAGCGGCGGACAGTGCGTCGTGGCTCTCTGCCGGAGGTGC
GCTGAGCTGTGGCGGCGCTACGGCGTCCGGTACGAGGAGATGGACGAGGGCGGCAAAAAGGCGGCCCAGTCCGGC
GGCAGAGCCTCGAAGCGTAAGCAGGACGAAGAGCTCCTCAAGCAGCAGCAGGCCGCCCAGGAGGTGAGCCTGACG
ACGCCGGACCGCGACAACACGCCCCAGAGCGTCCCCGCGCCGGCCGTCAGCCAGGAACCGCCGCGGAAGAAGCTT
AAGGGAGCTCCCTCGGATAGGGAGCCGGAACAGGCGTGTTCAGACGGAGGTGGCAGCGGATCGACGCCCAGCCTT
CCTAAGAAGAAGGAAAAGGCGGCGGATGCGACGCCGGTCCCGGAGATGCCGAAGCCGCGAACGCTTCCATGCGCC
ATCTGCCATCAGCTGGAGCCCCAGGGAGACCAGCATCTGTCTTGTCGAGAGTGCCGGCTGACGGTGCACCGCAAC
TGCTACGGTATCATGGACAACCGCATTCAGGGGAAATGGATCTGCGACATGTGCTCCAACGACAAGAGCCCGCAG
GTTTCTATCGTGAGTCGTTGGCAGCTGGTATTCTGGGTTGGCGGCTAACTGGGACGGCAGCAATACAAATGCGTC
CTCTGTCCTGTCGAGCACACTGAATGGGACTTTGTCGAGCAGCCCAAGCTCACTCACCACAAGAAGAAGATGTCA
GAAAAGGACCGGGGGCGGGAGAAGATGGAGGTGCAGCAGGCCCGCAAGGCTGCCGAGTTCTACCGCAAGAAGCAG
GAGGAGATGAACCGGCCGGTGAACCCGAGAGAGCCCCTGAAGCGGACGGCCGACAACAACTGGGTGCACGTTACG
TGCGCCGTCTGGACGCCCGAGGTCAAGTTTGGCAACGCAAAGGCGCTGGAGCCGTCAGAGGGGATACCGTCGATC
CCGAGGTCGAGATACGACGAGACGTGCCAGGCTTGCAGCCAGAAGGGCGGCGCGTGCATCTTTTGCCACCAGTGC
CGCGTTCCGTGTATGTCTTGATGTCATCTCTTGTCGTGACGGGGCTGACGGAGGGGGACAGATCACGTCGAGTGT
GCGCGTCAACAGGGTCACCTGCTCGGGTTCGACGTTACGCCGGTTAAGAGCTCGCGTCGAGACCAGTTCAACATC
GTGACGGTCAACGGAGAGAGCGGCACCATGTCGGCCGTCATGTGGTGCAAGGACCACGTGCCGACCAAGACGATG
GCGCACCGGATGGACGAGACGGCTGGCGATTCCGGCCTGAACGCGCTGCAGCTCTACGTGCAGAATTACAAGCAG
GCGGACCTGACGCTGACTGGCACCGTTCGCAAGGCCAACCTGATGATGAACGCGGCCAAGACGTCGTCGGCGCCC
CCCGTCCAGGTGCCTCGGCGGACGTCTGCCAGCGGAGGGCCCCCCGGAACCGTCAACGGACGGGCGCGCAGCAAC
GAGGCGACCGAATCGGCATCGTGCAACCCGCAGCAGGCGGGCGAGAAGGTGTGCATCACGTGTGGCGTCGACGTG
ACGCCCAAGTGGTGGCCCATCGACGACTCTCTCGGCCGGCGGCTCACCAACGGACACCACGGCGCTATCGGCTCC
GAGGCGCAGAAGTTTGTCGAGCAGCGGCGCTTCCAGTGTCACAAGTGCCGCAAGGCCGCCTGTCCTCCGATGCCG
TACTCGTCGCCCCCCCGTTATCGCGATGCCACCAGCAACGGCGGTCAGGGGGCCCGAGTGTCGCCGCCCGTCGAC
TACCGCCACGAGCTCCACGCCTTGCTACACCATCCGGCCTCTCACGGTCCACCGGCCCTACCTCCGGCTCCGACG
CTGGCTCCTCCCCCTCCGGCGGTGCCTCCCAGCGGCGGGCCCCCTCCAGCCCCCATGGCCGTCGCGGCACCGCAC
CATGGACCGACACACGTCATGGGACCGAGGCCGACCACGGCCGTGTCTCTGCCGTTCGTGGCCGCGCCGCCTTCC
CGGCACGGACACTACAACGAATGGAGCCATCAGCAGCCGCCGGGGCCCAGGCACGGGTCGCCGGCGCGCCACCTC
AACGGGGGACCGCCGCCGCTGCATGGCGGACCTCCTCCCGGTCCGCCGCCTCCACCGGCCATGTCGAGCCTCTCA
TCGCTCCGACCGCCGGCCATGTCGGGGCCGCCTCCCCCCATGGCTCACCATCACCCGCCCATGTACGGCAGCGGC
ATGCCCGTGTCTCCCCGACGGATGAGCGGGCCCACGCACCCGGCAGCATACGTTCCTCCGTACCACGGACCGGCG
GCTCACGGCGCGTCGCCGAGGCTGAGCAACGGAGTGCCGCCGCCCCCGCGAACGGAGACGTTCTCGCACGGGCTG
CACCCGCAGCGGTCGCCGTACTCGGGGAGCCCGCCGCTGCCTCGGAGCGGACTGCAGCCGGGACCTCACGAGAAC
GGAAGCAAGGTGGAGAGCTCGCAGGCAAACAAGCCGGCCAGCGGGGCCAGTGCGAGCCCGTCGCTGCGCAATCTG
CTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail