Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7073
Gene name
LocationContig_84:15441..16634
Strand-
Gene length (bp)1193
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 4.4E-18 12 149
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 3.8E-19 161 297
PF13669 Glyoxalase_4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 6.8E-07 161 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 1 299 2.0E-104
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 1 298 4.0E-96
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 7 153 6.0E-47
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 161 299 1.0E-46
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 10 161 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 1 299 2.0E-104
sp|P50107|LGUL_YEAST Lactoylglutathione lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO1 PE=1 SV=1 1 298 4.0E-96
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 7 153 6.0E-47
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 161 299 1.0E-46
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 10 161 4.0E-42
sp|P16635|LGUL_PSEPU Lactoylglutathione lyase OS=Pseudomonas putida GN=gloA PE=1 SV=3 10 155 3.0E-41
sp|Q09751|LGUL_SCHPO Lactoylglutathione lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo1 PE=1 SV=1 161 309 4.0E-39
sp|O04885|LGUL_BRAJU Lactoylglutathione lyase OS=Brassica juncea GN=GLY I PE=2 SV=1 162 298 6.0E-39
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 10 163 7.0E-39
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 10 161 1.0E-38
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 155 299 3.0E-38
sp|Q9HU72|LGUL_PSEAE Lactoylglutathione lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloA PE=3 SV=1 8 150 4.0E-38
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 162 301 4.0E-38
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 162 301 7.0E-38
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 162 301 9.0E-38
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 162 301 1.0E-37
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 10 155 2.0E-37
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 10 155 3.0E-37
sp|Q6P7Q4|LGUL_RAT Lactoylglutathione lyase OS=Rattus norvegicus GN=Glo1 PE=1 SV=3 10 150 9.0E-37
sp|Q4R5F2|LGUL_MACFA Lactoylglutathione lyase OS=Macaca fascicularis GN=GLO1 PE=2 SV=3 10 150 1.0E-36
sp|Q9CPU0|LGUL_MOUSE Lactoylglutathione lyase OS=Mus musculus GN=Glo1 PE=1 SV=3 10 150 2.0E-36
sp|Q9ZS21|LGUL_SOYBN Lactoylglutathione lyase OS=Glycine max GN=GLXI PE=1 SV=1 162 297 2.0E-36
sp|Q04760|LGUL_HUMAN Lactoylglutathione lyase OS=Homo sapiens GN=GLO1 PE=1 SV=4 10 150 3.0E-36
sp|Q8H0V3|LGUL_ARATH Lactoylglutathione lyase OS=Arabidopsis thaliana GN=At1g08110 PE=2 SV=1 162 298 5.0E-36
sp|Q42891|LGUL_SOLLC Lactoylglutathione lyase OS=Solanum lycopersicum GN=GLX1 PE=2 SV=1 162 300 7.0E-36
sp|O49818|LGUL_CICAR Lactoylglutathione lyase OS=Cicer arietinum PE=2 SV=1 162 298 9.0E-35
sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplastic OS=Arabidopsis thaliana GN=At1g67280 PE=1 SV=1 14 300 3.0E-26
sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 11 308 4.0E-25
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 162 305 2.0E-22
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 162 304 4.0E-22
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 162 299 4.0E-22
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 162 299 4.0E-22
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 162 300 5.0E-21
sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 11 298 5.0E-21
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 162 305 2.0E-20
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 162 305 2.0E-20
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 162 302 5.0E-20
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 162 299 1.0E-19
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 162 299 1.0E-19
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 162 299 1.0E-19
sp|Q55595|LGUL_SYNY3 Probable lactoylglutathione lyase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloA PE=3 SV=1 14 150 4.0E-19
sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 7 153 3.0E-18
sp|P0A0T3|LGUL_NEIMB Lactoylglutathione lyase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloA PE=3 SV=1 11 163 2.0E-17
sp|P0A0T2|LGUL_NEIMA Lactoylglutathione lyase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloA PE=3 SV=1 11 163 2.0E-17
sp|P46235|LGUL_VIBPA Probable lactoylglutathione lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloA PE=3 SV=2 11 153 3.0E-17
sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 11 153 2.0E-16
sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 11 153 2.0E-16
sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 11 153 2.0E-16
sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 11 153 2.0E-16
sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 11 153 2.0E-16
sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 14 161 9.0E-16
sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 162 299 5.0E-10
sp|P39586|YWBC_BACSU Uncharacterized protein YwbC OS=Bacillus subtilis (strain 168) GN=ywbC PE=3 SV=1 161 299 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4693
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7561
Ophiocordyceps australis map64 (Brazil) OphauB2|5332
Ophiocordyceps camponoti-floridani Ophcf2|01427
Ophiocordyceps camponoti-rufipedis Ophun1|7073 (this protein)
Ophiocordyceps kimflemingae Ophio5|2053
Ophiocordyceps subramaniannii Hirsu2|9884

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7073
MASATKLQTYKFNHSMIRVKNPTESIKFYKFLGMSLIQKLEYSEAKFDLYFLGYDSPHAPSHGNKFADREGLIEL
THNYGTEEDAGFKVNNGNKEPHRGFGHTCISVDNIQAACQRIEDAGYKFQKKLTDGSMKHIAFALDPDGYWVEII
GQKPVEETANNHTMIRVKDAEKSLAFYQDVMGMKLMRTHEAKSAGFNLYFLGYPGEQGMPQESTMSHREGLLELT
WNYGTEKKAEFKYHSGNEEPKGFGHICVSVDDLDAACKRFDDLGCKWQKRLQDGNMKIVAFLLDPDGYWIEVIQN
PQYSDKYQV*
Coding >Ophun1|7073
ATGGCGTCCGCAACGAAGCTGCAGACGTACAAATTCAACCATTCCATGATTCGGGTCAAGAATCCTACCGAGTCA
ATCAAGTTCTACAAGTTCTTGGGCATGAGTCTGATTCAAAAGCTTGAGTACTCAGAGGCCAAGTTTGATCTCTAC
TTCCTCGGCTACGACAGCCCTCACGCGCCCTCGCATGGAAACAAATTCGCCGATCGCGAGGGCCTCATCGAGCTC
ACCCACAACTACGGGACCGAAGAGGACGCAGGTTTCAAGGTCAACAACGGGAATAAGGAGCCTCATCGCGGCTTT
GGTCACACTTGTATCAGCGTCGACAACATTCAGGCTGCCTGTCAGCGCATCGAAGACGCAGGCTACAAGTTTCAG
AAGAAGCTTACGGACGGGTCCATGAAACACATCGCCTTCGCCCTGGATCCCGACGGTTACTGGGTTGAAATCATC
GGTCAGAAGCCTGTTGAGGAGACAGCCAATAACCACACCATGATTCGAGTCAAGGATGCCGAAAAGTCTCTCGCC
TTCTACCAAGACGTCATGGGCATGAAGCTTATGCGGACGCACGAAGCCAAGAGCGCCGGCTTCAACCTCTACTTC
CTCGGATACCCGGGAGAGCAGGGCATGCCTCAGGAGAGCACCATGAGCCATCGCGAGGGGCTGCTGGAGCTGACG
TGGAACTACGGCACCGAGAAGAAAGCCGAGTTCAAGTACCACAGCGGCAACGAGGAACCCAAGGGCTTTGGTCAT
ATCTGTGTTTCCGTCGATGATCTTGATGCTGCTTGTAAGAGGTTCGACGACCTTGGCTGCAAGTGGCAGAAGCGG
CTCCAGGACGGGAACATGAAAATTGTGGCCTTTTTGCTCGATCCGGATGGATACTGGATCGAAGTCATCCAGAAT
CCACAATACAGTGACAAGTATCAAGTGTAA
Transcript >Ophun1|7073
ATGGCGTCCGCAACGAAGCTGCAGACGTACAAATTCAACCATTCCATGATTCGGGTCAAGAATCCTACCGAGTCA
ATCAAGTTCTACAAGTTCTTGGGCATGAGTCTGATTCAAAAGCTTGAGTACTCAGAGGCCAAGTTTGATCTCTAC
TTCCTCGGCTACGACAGCCCTCACGCGCCCTCGCATGGAAACAAATTCGCCGATCGCGAGGGCCTCATCGAGCTC
ACCCACAACTACGGGACCGAAGAGGACGCAGGTTTCAAGGTCAACAACGGGAATAAGGAGCCTCATCGCGGCTTT
GGTCACACTTGTATCAGCGTCGACAACATTCAGGCTGCCTGTCAGCGCATCGAAGACGCAGGCTACAAGTTTCAG
AAGAAGCTTACGGACGGGTCCATGAAACACATCGCCTTCGCCCTGGATCCCGACGGTTACTGGGTTGAAATCATC
GGTCAGAAGCCTGTTGAGGAGACAGCCAATAACCACACCATGATTCGAGTCAAGGATGCCGAAAAGTCTCTCGCC
TTCTACCAAGACGTCATGGGCATGAAGCTTATGCGGACGCACGAAGCCAAGAGCGCCGGCTTCAACCTCTACTTC
CTCGGATACCCGGGAGAGCAGGGCATGCCTCAGGAGAGCACCATGAGCCATCGCGAGGGGCTGCTGGAGCTGACG
TGGAACTACGGCACCGAGAAGAAAGCCGAGTTCAAGTACCACAGCGGCAACGAGGAACCCAAGGGCTTTGGTCAT
ATCTGTGTTTCCGTCGATGATCTTGATGCTGCTTGTAAGAGGTTCGACGACCTTGGCTGCAAGTGGCAGAAGCGG
CTCCAGGACGGGAACATGAAAATTGTGGCCTTTTTGCTCGATCCGGATGGATACTGGATCGAAGTCATCCAGAAT
CCACAATACAGTGACAAGTATCAAGTGTAA
Gene >Ophun1|7073
ATGGCGTCCGCAACGAAGCTGCAGACGTACAAATTCAACCATTCCATGTGAGCAGCTTTCCCGCACTTTTCCATC
TTGTATTATTCCCTGACCAAGCTCAGGATTCGGGTCAAGAATCCTACCGAGTCAAGTAGGCCCGGCCCCTGCGAA
GCAGTCCTGGAGGCAGCCAGCTGACGTCGCTCAGTCAAGTTCTACAAGTTCTTGGGCATGAGTCTGATTCAAAAG
CTTGAGTACTCAGAGGCCAAGTTTGATCTCTACTTCCTCGGCTACGACAGCCCTCACGCGCCCTCGCATGGAAAC
AAATTCGCCGATCGCGAGGGCCTCATCGAGCTCACCCACAACTACGGGACCGAAGAGGACGCAGGTTTCAAGGTC
AACAACGGGAATAAGGAGCCTCATCGCGGCTTTGGTCACACTTGTATCAGCGTCGACAACATTCAGGCTGCCTGT
CAGCGCATCGAAGACGCAGGCTACAAGTTTCAGAAGAAGCTTACGGACGGGTCCATGAAACACATCGCCTTCGCC
CTGGATCCCGACGGTTACTGGGTTGAAATCATCGGTCAGAAGCCTGTTGAGGAGACAGCCAATGTCAAAGACACC
GACTTATCCACGTATCGCATGGCAAGGACCCTCCCCCTTCCCCGACCAAGATGTCCTTGGGCTAACCCGTCGTCC
AGAACCACACCATGATTCGAGTCAAGGATGCCGAAAAGTCTCTCGCCTTCTACCAAGACGTCATGGGCATGAAGC
TTATGCGGACGCACGAAGCCAAGAGCGCCGGCTTCAACCTCTACTTCCTCGGATACCCGGGAGAGCAGGGCATGC
CTCAGGAGAGCACCATGAGCCATCGCGAGGGGCTGCTGGAGCTGACGTGGAACTACGGCACCGAGAAGAAAGCCG
AGTTCAAGTACCACAGCGGCAACGAGGAACCCAAGGGCTTTGGTCATATCTGTGAGCGTCCCCACTCCCGCCGAC
GTTGCCAGTGACTGGGCTGATTTCTTTGTGCCATTCTCTTAGGTGTTTCCGTCGATGATCTTGATGCTGCTTGTA
AGAGGTTCGACGACCTTGGCTGCAAGTGGCAGAAGCGGCTCCAGGACGGGAACATGAAAATTGTGGCCTTTTTGC
TCGATCCGGATGGATACTGGATCGAAGTCATCCAGAATCCACAATACAGTGACAAGTATCAAGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail