Protein ID | Ophun1|7064 |
Gene name | |
Location | Contig_839:4641..4963 |
Strand | + |
Gene length (bp) | 322 |
Transcript length (bp) | 219 |
Coding sequence length (bp) | 219 |
Protein length (aa) | 73 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF12554 | MOZART1 | Mitotic-spindle organizing gamma-tubulin ring associated | 6.8E-24 | 11 | 57 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A4QYG1|MZT1_MAGO7 | Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 | 5 | 71 | 2.0E-23 |
sp|Q5BDL9|MZT1_EMENI | Mitotic-spindle organizing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1361 PE=3 SV=1 | 5 | 63 | 8.0E-21 |
sp|Q1DRC2|MZT1_COCIM | Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 | 1 | 65 | 2.0E-19 |
sp|Q2GVR6|MZT1_CHAGB | Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 | 1 | 61 | 1.0E-18 |
sp|A7EXZ2|MZT1_SCLS1 | Mitotic-spindle organizing protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10207 PE=3 SV=1 | 2 | 65 | 3.0E-18 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|A4QYG1|MZT1_MAGO7 | Mitotic-spindle organizing protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_14000 PE=3 SV=1 | 5 | 71 | 2.0E-23 |
sp|Q5BDL9|MZT1_EMENI | Mitotic-spindle organizing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1361 PE=3 SV=1 | 5 | 63 | 8.0E-21 |
sp|Q1DRC2|MZT1_COCIM | Mitotic-spindle organizing protein 1 OS=Coccidioides immitis (strain RS) GN=CIMG_07141 PE=3 SV=1 | 1 | 65 | 2.0E-19 |
sp|Q2GVR6|MZT1_CHAGB | Mitotic-spindle organizing protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_07938 PE=3 SV=1 | 1 | 61 | 1.0E-18 |
sp|A7EXZ2|MZT1_SCLS1 | Mitotic-spindle organizing protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10207 PE=3 SV=1 | 2 | 65 | 3.0E-18 |
sp|A6S6H9|MZT1_BOTFB | Mitotic-spindle organizing protein 1 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_08507 PE=3 SV=1 | 2 | 66 | 4.0E-18 |
sp|A1CQI3|MZT1_ASPCL | Mitotic-spindle organizing protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_026210 PE=3 SV=1 | 1 | 59 | 5.0E-18 |
sp|Q0VFD6|MZT1_XENTR | Mitotic-spindle organizing protein 1 OS=Xenopus tropicalis GN=mzt1 PE=3 SV=1 | 4 | 69 | 5.0E-14 |
sp|B5FXZ4|MZT1_TAEGU | Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata GN=mzt1 PE=3 SV=1 | 9 | 57 | 8.0E-14 |
sp|Q5U4M5|MZT1_XENLA | Mitotic-spindle organizing protein 1 OS=Xenopus laevis GN=mzt1 PE=3 SV=2 | 4 | 69 | 1.0E-13 |
sp|Q8BUR9|MZT1_MOUSE | Mitotic-spindle organizing protein 1 OS=Mus musculus GN=Mzt1 PE=1 SV=1 | 9 | 57 | 2.0E-13 |
sp|Q08AG7|MZT1_HUMAN | Mitotic-spindle organizing protein 1 OS=Homo sapiens GN=MZT1 PE=1 SV=2 | 9 | 57 | 4.0E-13 |
sp|P0C8Y1|MZT1_DANRE | Mitotic-spindle organizing protein 1 OS=Danio rerio GN=mzt1 PE=3 SV=1 | 2 | 57 | 4.0E-13 |
sp|P0CP04|MZT1_CRYNJ | Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA01750 PE=3 SV=1 | 10 | 59 | 9.0E-13 |
sp|P0CP05|MZT1_CRYNB | Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBA1680 PE=3 SV=1 | 10 | 59 | 9.0E-13 |
sp|P0CF96|MZT1_SCHPO | Mitotic-spindle organizing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mzt1 PE=1 SV=3 | 9 | 58 | 7.0E-12 |
sp|A9NKD9|MZT1_PICSI | Mitotic-spindle organizing protein 1 OS=Picea sitchensis PE=3 SV=1 | 10 | 60 | 1.0E-11 |
sp|Q9M0N8|MZT1B_ARATH | Mitotic-spindle organizing protein 1B OS=Arabidopsis thaliana GN=GIP1 PE=1 SV=1 | 3 | 60 | 2.0E-10 |
sp|Q9C9T3|MZT1A_ARATH | Mitotic-spindle organizing protein 1A OS=Arabidopsis thaliana GN=GIP2 PE=1 SV=1 | 10 | 57 | 3.0E-08 |
sp|B4N369|MZT1_DROWI | Mitotic-spindle organizing protein 1 OS=Drosophila willistoni GN=GK12642 PE=3 SV=1 | 11 | 61 | 1.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0033566 | gamma-tubulin complex localization | Yes |
GO:0000931 | gamma-tubulin large complex | Yes |
GO:0051179 | localization | No |
GO:0000930 | gamma-tubulin complex | No |
GO:0031503 | protein-containing complex localization | No |
GO:0005575 | cellular_component | No |
GO:0008150 | biological_process | No |
GO:0032991 | protein-containing complex | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 51 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|7064 MPDSDKHAAAQQAVDILHEIAIILNTNLDRRTLSICISMIERGVNPEALAQVIKELRLEAQLAEGNASTTRP* |
Coding | >Ophun1|7064 ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAC ACCAACCTGGATCGTCGCACCTTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCG CAAGTCATCAAGGAACTGCGTCTCGAGGCACAACTCGCCGAAGGCAACGCATCAACGACGCGTCCGTAA |
Transcript | >Ophun1|7064 ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGAAC ACCAACCTGGATCGTCGCACCTTGTCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCG CAAGTCATCAAGGAACTGCGTCTCGAGGCACAACTCGCCGAAGGCAACGCATCAACGACGCGTCCGTAA |
Gene | >Ophun1|7064 ATGCCCGACTCAGACAAACACGCAGCCGCGCAACAAGCCGTCGACATCCTCCACGAGATTGCCATCATCCTGGTC CGTCGCCCAGCCCCCGACCCTCTGCGCCTCCCTCGCTAACAGCCGCAGAACACCAACCTGGATCGTCGCACCTTG TCCATCTGCATCTCCATGATCGAGCGCGGCGTCAACCCGGAAGCTCTTGCGGTACGCGTCCTCTTTCCTTGCCCC TGAGGTATTTGCTGACGCGTCTCCGCAGCAAGTCATCAAGGAACTGCGTCTCGAGGCACAACTCGCCGAAGGCAA CGCATCAACGACGCGTCCGTAA |