Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7063
Gene name
LocationContig_839:1561..4024
Strand-
Gene length (bp)2463
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 8.0E-87 67 309
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 5.2E-63 543 740
PF02815 MIR MIR domain 1.1E-37 357 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 60 744 0.0E+00
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 6 744 0.0E+00
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 65 742 0.0E+00
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 1 743 0.0E+00
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 65 744 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 60 744 0.0E+00
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 6 744 0.0E+00
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 65 742 0.0E+00
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 1 743 0.0E+00
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 65 744 0.0E+00
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 49 744 0.0E+00
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 14 740 3.0E-146
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 14 740 2.0E-143
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 27 741 2.0E-142
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 27 741 1.0E-135
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 70 714 1.0E-126
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 66 740 9.0E-116
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 68 742 4.0E-99
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 68 742 2.0E-98
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 78 742 4.0E-98
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 70 688 1.0E-95
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 62 740 5.0E-90
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 18 723 2.0E-89
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 62 740 6.0E-88
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 67 691 1.0E-84
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 19 742 1.0E-83
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 31 740 1.0E-79
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 66 725 2.0E-77
sp|Q06644|PMT7_YEAST Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT7 PE=1 SV=1 229 532 9.0E-18
sp|Q93ZE8|SDF2_ARATH Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana GN=SDF2 PE=1 SV=1 358 513 3.0E-11
sp|Q3SZ45|SDF2_BOVIN Stromal cell-derived factor 2 OS=Bos taurus GN=SDF2 PE=2 SV=1 330 474 9.0E-09
sp|Q8NRZ6|PMT_CORGL Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pmt PE=3 SV=1 105 417 1.0E-08
sp|Q99470|SDF2_HUMAN Stromal cell-derived factor 2 OS=Homo sapiens GN=SDF2 PE=1 SV=2 330 474 1.0E-08
sp|Q3T083|SDF2L_BOVIN Stromal cell-derived factor 2-like protein 1 OS=Bos taurus GN=SDF2L1 PE=2 SV=1 358 466 2.0E-08
sp|Q9DCT5|SDF2_MOUSE Stromal cell-derived factor 2 OS=Mus musculus GN=Sdf2 PE=1 SV=1 330 474 3.0E-08
sp|Q9HCN8|SDF2L_HUMAN Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens GN=SDF2L1 PE=1 SV=2 358 466 5.0E-08
sp|Q9ESP1|SDF2L_MOUSE Stromal cell-derived factor 2-like protein 1 OS=Mus musculus GN=Sdf2l1 PE=1 SV=2 358 457 6.0E-08
sp|Q54P23|SDF2_DICDI Stromal cell-derived factor 2-like protein OS=Dictyostelium discoideum GN=DDB_G0284847 PE=3 SV=1 381 527 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006493 protein O-linked glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0043412 macromolecule modification No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0006486 protein glycosylation No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 146 165 19
3 193 215 22
4 230 252 22
5 287 309 22
6 604 626 22
7 646 668 22
8 672 691 19
9 704 726 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7063
MAAEKATVVSGADVGAGLRKRPVGEARGPPSPRVSQPDVGAKKRTAAKDVDLFDAFDDWEPIFAPLLFTLLALLT
RLWKIGLSNIVTWDEAHFGKFGSYYIKHEYYFDVHPPLGKMLVGLSGVLAGYNGSFEFKSGEKYPEDVNFAFMRA
FNAFFGIVCVPLAYYTARELHLRRPAVWLVALMVLCENSYTTISRFILLDSMLLCGTVATVFCWAKFHNQRHNSF
EPEWFFWLFMTGISIGCVCSVKLVGLFVTALVGLYTAEDLWNKFGDTKMPLTTLGAHFITRVVGLILVPFLIYLL
SFALHFAILDRTGPGDAQMSSLFQANLKGTEVGRDSPLEVVIGSRVTLKNMGYGGGLLHSHVQTYPEGSQQQQVT
CYHHKDANNDWFIYPNRGEPEYDNESKDVRFIGDGTTIRLIHAQTGRNLHSHDIAAPMSKADKEVSCYGNLTIGD
NKDHWKIEVVRDAASRDHSKIRTLTTGFRLKHEVMGCYLRAGNKNLPQWGFRQIEVTCTKDNNPRDTYTHWNVEA
HVNEKLPPGDPGVYKSPFFHDFVHLNVAMMTSNNALVPDPDKQDDLASQWWQWPFLHVGLRMCGWDDNIVKYFLL
GNPFVYWATTAGLAMTGMVVMWYLLLWQRGFRVLSRKDVDQFHYSGIYPAAGWFLHYLPFVVMARVTYVHHYYPA
LYFAILTFGFLVDWSVRMRGRTVQSVVYGTLYTVVIGLYILFIPVCWGMTGPNKQYSYLKWFDNWRISD*
Coding >Ophun1|7063
ATGGCTGCGGAAAAGGCCACCGTCGTCTCTGGCGCCGACGTCGGCGCCGGGCTGAGGAAGCGGCCTGTTGGTGAG
GCGCGGGGGCCTCCGTCTCCTCGTGTCTCGCAGCCCGACGTCGGGGCGAAGAAGCGGACTGCTGCCAAGGATGTT
GATCTTTTCGACGCTTTTGACGACTGGGAGCCCATCTTTGCCCCACTCCTCTTCACCTTGCTGGCTCTCTTGACC
AGGCTGTGGAAGATTGGTCTGAGCAACATCGTGACCTGGGACGAAGCTCACTTTGGCAAGTTCGGCAGCTATTAC
ATCAAACATGAGTACTACTTCGACGTCCACCCTCCCCTCGGCAAGATGCTCGTCGGCCTCTCGGGCGTCCTCGCC
GGCTACAACGGCTCATTCGAGTTCAAGTCGGGCGAAAAGTACCCGGAAGACGTCAACTTTGCCTTTATGCGAGCC
TTCAACGCATTCTTCGGTATCGTTTGTGTCCCGCTGGCCTATTACACAGCTCGCGAACTTCACCTGCGACGTCCT
GCCGTTTGGCTCGTCGCTCTCATGGTCCTCTGCGAGAATTCTTATACCACCATCAGCAGGTTCATCCTTCTCGAC
TCTATGCTGCTCTGCGGCACCGTCGCTACCGTCTTCTGCTGGGCCAAGTTTCACAACCAGCGTCACAACAGCTTC
GAGCCCGAGTGGTTCTTTTGGCTCTTTATGACGGGCATCAGCATTGGATGCGTCTGCAGTGTCAAGCTCGTTGGC
CTCTTCGTTACCGCTCTCGTCGGTCTGTACACGGCCGAAGATCTTTGGAATAAGTTTGGTGACACCAAGATGCCG
CTGACGACACTCGGCGCTCACTTTATAACACGCGTCGTCGGACTTATTCTCGTGCCGTTCCTCATCTATCTCCTG
TCTTTTGCCCTGCACTTTGCCATCCTCGACCGGACGGGCCCCGGCGACGCACAGATGAGCTCGCTCTTCCAGGCC
AACCTCAAGGGCACCGAAGTCGGCAGGGACAGTCCTCTCGAGGTGGTCATCGGTTCGCGCGTCACGCTCAAGAAC
ATGGGCTACGGAGGAGGCCTGCTCCATTCGCACGTCCAGACGTACCCCGAGGGCTCGCAGCAGCAGCAAGTTACC
TGCTACCACCACAAGGACGCAAACAACGATTGGTTCATCTACCCGAACCGCGGCGAGCCAGAGTACGACAACGAG
TCCAAGGATGTGCGCTTCATCGGCGACGGCACCACCATCCGCCTGATCCACGCCCAGACCGGCCGCAACTTACAC
TCGCACGACATCGCCGCGCCTATGAGCAAGGCCGACAAGGAGGTTTCGTGCTACGGCAACCTGACGATTGGCGAC
AACAAGGACCACTGGAAGATTGAGGTGGTTCGCGACGCCGCTTCCCGGGACCACAGCAAGATCCGTACCCTGACG
ACGGGCTTCCGTCTCAAGCACGAGGTCATGGGCTGCTACTTGAGGGCCGGCAATAAGAACCTGCCCCAATGGGGC
TTCAGGCAGATCGAGGTGACGTGCACCAAGGACAACAACCCTCGCGACACGTACACGCACTGGAACGTCGAAGCT
CACGTCAACGAAAAGTTGCCCCCCGGCGATCCCGGCGTCTACAAGTCTCCCTTCTTCCACGACTTCGTTCACCTC
AACGTGGCCATGATGACGTCCAACAACGCGCTGGTGCCGGACCCCGACAAGCAAGACGATCTGGCCTCGCAGTGG
TGGCAGTGGCCCTTTTTGCACGTCGGCCTTCGCATGTGCGGCTGGGACGATAACATCGTCAAGTACTTTTTGCTG
GGCAACCCCTTCGTCTACTGGGCCACGACGGCCGGCCTGGCCATGACGGGCATGGTGGTCATGTGGTACCTGCTG
CTGTGGCAGCGTGGCTTCAGGGTCCTGAGCCGCAAGGATGTCGACCAGTTCCATTACTCGGGCATCTATCCCGCG
GCCGGATGGTTCTTGCATTACCTACCGTTCGTCGTCATGGCCCGCGTCACCTACGTCCATCACTACTATCCGGCG
CTGTACTTTGCCATCCTCACCTTTGGCTTCCTGGTTGACTGGAGCGTGAGGATGCGGGGCCGGACGGTGCAGAGC
GTGGTGTACGGGACGCTTTACACCGTCGTCATCGGTCTCTACATCCTGTTTATACCCGTCTGCTGGGGGATGACG
GGGCCGAACAAGCAGTACAGCTATTTGAAGTGGTTCGATAACTGGCGCATCTCGGATTGA
Transcript >Ophun1|7063
ATGGCTGCGGAAAAGGCCACCGTCGTCTCTGGCGCCGACGTCGGCGCCGGGCTGAGGAAGCGGCCTGTTGGTGAG
GCGCGGGGGCCTCCGTCTCCTCGTGTCTCGCAGCCCGACGTCGGGGCGAAGAAGCGGACTGCTGCCAAGGATGTT
GATCTTTTCGACGCTTTTGACGACTGGGAGCCCATCTTTGCCCCACTCCTCTTCACCTTGCTGGCTCTCTTGACC
AGGCTGTGGAAGATTGGTCTGAGCAACATCGTGACCTGGGACGAAGCTCACTTTGGCAAGTTCGGCAGCTATTAC
ATCAAACATGAGTACTACTTCGACGTCCACCCTCCCCTCGGCAAGATGCTCGTCGGCCTCTCGGGCGTCCTCGCC
GGCTACAACGGCTCATTCGAGTTCAAGTCGGGCGAAAAGTACCCGGAAGACGTCAACTTTGCCTTTATGCGAGCC
TTCAACGCATTCTTCGGTATCGTTTGTGTCCCGCTGGCCTATTACACAGCTCGCGAACTTCACCTGCGACGTCCT
GCCGTTTGGCTCGTCGCTCTCATGGTCCTCTGCGAGAATTCTTATACCACCATCAGCAGGTTCATCCTTCTCGAC
TCTATGCTGCTCTGCGGCACCGTCGCTACCGTCTTCTGCTGGGCCAAGTTTCACAACCAGCGTCACAACAGCTTC
GAGCCCGAGTGGTTCTTTTGGCTCTTTATGACGGGCATCAGCATTGGATGCGTCTGCAGTGTCAAGCTCGTTGGC
CTCTTCGTTACCGCTCTCGTCGGTCTGTACACGGCCGAAGATCTTTGGAATAAGTTTGGTGACACCAAGATGCCG
CTGACGACACTCGGCGCTCACTTTATAACACGCGTCGTCGGACTTATTCTCGTGCCGTTCCTCATCTATCTCCTG
TCTTTTGCCCTGCACTTTGCCATCCTCGACCGGACGGGCCCCGGCGACGCACAGATGAGCTCGCTCTTCCAGGCC
AACCTCAAGGGCACCGAAGTCGGCAGGGACAGTCCTCTCGAGGTGGTCATCGGTTCGCGCGTCACGCTCAAGAAC
ATGGGCTACGGAGGAGGCCTGCTCCATTCGCACGTCCAGACGTACCCCGAGGGCTCGCAGCAGCAGCAAGTTACC
TGCTACCACCACAAGGACGCAAACAACGATTGGTTCATCTACCCGAACCGCGGCGAGCCAGAGTACGACAACGAG
TCCAAGGATGTGCGCTTCATCGGCGACGGCACCACCATCCGCCTGATCCACGCCCAGACCGGCCGCAACTTACAC
TCGCACGACATCGCCGCGCCTATGAGCAAGGCCGACAAGGAGGTTTCGTGCTACGGCAACCTGACGATTGGCGAC
AACAAGGACCACTGGAAGATTGAGGTGGTTCGCGACGCCGCTTCCCGGGACCACAGCAAGATCCGTACCCTGACG
ACGGGCTTCCGTCTCAAGCACGAGGTCATGGGCTGCTACTTGAGGGCCGGCAATAAGAACCTGCCCCAATGGGGC
TTCAGGCAGATCGAGGTGACGTGCACCAAGGACAACAACCCTCGCGACACGTACACGCACTGGAACGTCGAAGCT
CACGTCAACGAAAAGTTGCCCCCCGGCGATCCCGGCGTCTACAAGTCTCCCTTCTTCCACGACTTCGTTCACCTC
AACGTGGCCATGATGACGTCCAACAACGCGCTGGTGCCGGACCCCGACAAGCAAGACGATCTGGCCTCGCAGTGG
TGGCAGTGGCCCTTTTTGCACGTCGGCCTTCGCATGTGCGGCTGGGACGATAACATCGTCAAGTACTTTTTGCTG
GGCAACCCCTTCGTCTACTGGGCCACGACGGCCGGCCTGGCCATGACGGGCATGGTGGTCATGTGGTACCTGCTG
CTGTGGCAGCGTGGCTTCAGGGTCCTGAGCCGCAAGGATGTCGACCAGTTCCATTACTCGGGCATCTATCCCGCG
GCCGGATGGTTCTTGCATTACCTACCGTTCGTCGTCATGGCCCGCGTCACCTACGTCCATCACTACTATCCGGCG
CTGTACTTTGCCATCCTCACCTTTGGCTTCCTGGTTGACTGGAGCGTGAGGATGCGGGGCCGGACGGTGCAGAGC
GTGGTGTACGGGACGCTTTACACCGTCGTCATCGGTCTCTACATCCTGTTTATACCCGTCTGCTGGGGGATGACG
GGGCCGAACAAGCAGTACAGCTATTTGAAGTGGTTCGATAACTGGCGCATCTCGGATTGA
Gene >Ophun1|7063
ATGGCTGCGGAAAAGGCCACCGTCGTCTCTGGCGCCGACGTCGGCGCCGGGCTGAGGAAGCGGCCTGTTGGTGAG
GCGCGGGGGCCTCCGTCTCCTCGTGTCTCGCAGCCCGACGTCGGGGCGAAGAAGCGGACTGCTGCCAAGGTGAAC
CGACCGCTCGGCACCACGCCCTCTCTGCCTGCTTGTTGCTGACCTTTGCCCAGGATGTTGATCTTTTCGACGCTT
TTGACGACTGGGAGCCCATCTTTGCCCCACTCCTCTTCACCTTGCTGGCTCTCTTGACCAGGCTGTGGAAGATTG
GTCTGAGCAACATCGTGACCTGGGACGAAGCTCAGTACGTCATCTGTTCTCGCCTGTGTTGGACGATACGCTGAC
GAGACAATCGCAGCTTTGGCAAGTTCGGCAGCTATTACATCAAACATGAGTACTACTTCGACGTCCACCCTCCCC
TCGGCAAGATGCTCGTCGGCCTCTCGGGCGTCCTCGCCGGCTACAACGGCTCATTCGAGTTCAAGTCGGGCGAAA
AGTACCCGGAAGACGTCAACTTTGCCTTTATGCGAGCCTTCAACGCATTCTTCGGTATCGTTTGTGTCCCGCTGG
CCTATTACACAGCTCGCGAACTTCACCTGCGACGTCCTGCCGTTTGGCTCGTCGCTCTCATGGTCCTCTGCGAGA
ATTCTTATACCACCATCAGCAGGTTCATCCTTCTCGACTCTATGCTGCTCTGCGGCACCGTCGCTACCGTCTTCT
GCTGGGCCAAGTTTCACAACCAGCGTCACAACAGCTTCGAGCCCGAGTGGTTCTTTTGGCTCTTTATGACGGGCA
TCAGCATTGGATGCGTCTGCAGTGTCAAGCTCGTTGGCCTCTTCGTTACCGCTCTCGTCGGTCTGTACACGGCCG
AAGATCTTTGGAATAAGTTTGGTGACACCAAGATGCCGCTGGTGAGTTGCCCCTGAGCCCTACATACATGGACGC
TTCTAACCTCTCGATAGACGACACTCGGCGCTCACTTTATAACACGCGTCGTCGGACTTATTCTCGTGCCGTTCC
TCATCTATCTCCTGTCTTTTGCCCTGCACTTTGCCATCCTCGACCGGACGGGCCCCGGCGACGCACAGATGAGCT
CGCTCTTCCAGGCCAACCTCAAGGGCACCGAAGTCGGCAGGGACAGTCCTCTCGAGGTGGTCATCGGTTCGCGCG
TCACGCTCAAGAACATGGGCTACGGAGGAGGCCTGCTCCATTCGCACGTCCAGACGTACCCCGAGGGCTCGCAGC
AGCAGCAAGTTACCTGCTACCACCACAAGGACGCAAACAACGATTGGTTCATCTACCCGAACCGCGGCGAGCCAG
AGTACGACAACGAGTCCAAGGATGTGCGCTTCATCGGCGACGGCACCACCATCCGCCTGATCCACGCCCAGACCG
GCCGCAACTTACACTCGCACGACATCGCCGCGCCTATGAGCAAGGCCGACAAGGAGGTTTCGTGCTACGGCAACC
TGACGATTGGCGACAACAAGGACCACTGGAAGATTGAGGTGGTTCGCGACGCCGCTTCCCGGGACCACAGCAAGA
TCCGTACCCTGACGACGGGCTTCCGTCTCAAGCACGAGGTCATGGGCTGCTACTTGAGGGCCGGCAATAAGAACC
TGCCCCAATGGGGCTTCAGGCAGATCGAGGTGACGTGCACCAAGGACAACAACCCTCGCGACACGTACACGCACT
GGAACGTCGAAGCTCACGTCAACGAAAAGTGTAAGTGTCGCCGCGAGCTCATGGTCGCATAGTGTTGAGACAACT
GCTGACTGCGAGTTTTCAGTGCCCCCCGGCGATCCCGGCGTCTACAAGTCTCCCTTCTTCCACGACTTCGTTCAC
CTCAACGTGGCCATGATGACGTCCAACAACGCGCTGGTGCCGGACCCCGACAAGCAAGACGATCTGGCCTCGCAG
TGGTGGCAGTGGCCCTTTTTGCACGTCGGCCTTCGCATGTGCGGCTGGGACGATAACATCGTCAAGTACTTTTTG
CTGGGCAACCCCTTCGTCTACTGGGCCACGACGGCCGGCCTGGCCATGACGGGCATGGTGGTCATGTGGTACCTG
CTGCTGTGGCAGCGTGGCTTCAGGGTCCTGAGCCGCAAGGATGTCGACCAGTTCCATTACTCGGGCATCTATCCC
GCGGCCGGATGGTTCTTGCATTACCTACCGTTCGTCGTCATGGCCCGCGTCACCTACGTCCATCACTACTATCCG
GCGCTGTACTTTGCCATCCTCACCTTTGGCTTCCTGGTTGACTGGAGCGTGAGGATGCGGGGCCGGACGGTGCAG
AGCGTGGTGTACGGGACGCTTTACACCGTCGTCATCGGTCTCTACATCCTGTTTATACCCGTCTGCTGGGGGATG
ACGGGGCCGAACAAGCAGTACAGCTATTTGAAGTGGTTCGATAACTGGCGCATCTCGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail