Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7050
Gene name
LocationContig_834:4361..5615
Strand+
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00764 Arginosuc_synth Arginosuccinate synthase 1.5E-136 9 403

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22768|ASSY_YEAST Argininosuccinate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG1 PE=1 SV=3 4 415 2.0E-168
sp|O94354|ASSY_SCHPO Argininosuccinate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg12 PE=3 SV=1 7 407 2.0E-165
sp|Q66I24|ASSY_DANRE Argininosuccinate synthase OS=Danio rerio GN=ass1 PE=2 SV=1 4 416 2.0E-146
sp|Q5ZJ23|ASSY_CHICK Argininosuccinate synthase OS=Gallus gallus GN=ASS1 PE=2 SV=1 1 409 2.0E-146
sp|Q5M8Z6|ASSY_XENTR Argininosuccinate synthase OS=Xenopus tropicalis GN=ass1 PE=2 SV=1 1 403 3.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22768|ASSY_YEAST Argininosuccinate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG1 PE=1 SV=3 4 415 2.0E-168
sp|O94354|ASSY_SCHPO Argininosuccinate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg12 PE=3 SV=1 7 407 2.0E-165
sp|Q66I24|ASSY_DANRE Argininosuccinate synthase OS=Danio rerio GN=ass1 PE=2 SV=1 4 416 2.0E-146
sp|Q5ZJ23|ASSY_CHICK Argininosuccinate synthase OS=Gallus gallus GN=ASS1 PE=2 SV=1 1 409 2.0E-146
sp|Q5M8Z6|ASSY_XENTR Argininosuccinate synthase OS=Xenopus tropicalis GN=ass1 PE=2 SV=1 1 403 3.0E-144
sp|B9K8S7|ASSY_THENN Argininosuccinate synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=argG PE=3 SV=1 5 403 2.0E-143
sp|Q7ZWM4|ASSY_XENLA Argininosuccinate synthase OS=Xenopus laevis GN=ass1 PE=2 SV=1 1 403 2.0E-142
sp|P14568|ASSY_BOVIN Argininosuccinate synthase OS=Bos taurus GN=ASS1 PE=2 SV=1 1 403 4.0E-142
sp|Q9X2A1|ASSY_THEMA Argininosuccinate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argG PE=1 SV=1 5 411 5.0E-142
sp|P16460|ASSY_MOUSE Argininosuccinate synthase OS=Mus musculus GN=Ass1 PE=1 SV=1 4 403 9.0E-142
sp|A5ILL1|ASSY_THEP1 Argininosuccinate synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=argG PE=3 SV=1 5 411 4.0E-141
sp|B1LAP4|ASSY_THESQ Argininosuccinate synthase OS=Thermotoga sp. (strain RQ2) GN=argG PE=3 SV=1 5 411 1.0E-140
sp|P00966|ASSY_HUMAN Argininosuccinate synthase OS=Homo sapiens GN=ASS1 PE=1 SV=2 4 403 3.0E-140
sp|P09034|ASSY_RAT Argininosuccinate synthase OS=Rattus norvegicus GN=Ass1 PE=1 SV=1 4 403 3.0E-140
sp|Q7PR38|ASSY_ANOGA Argininosuccinate synthase OS=Anopheles gambiae GN=AGAP003015 PE=3 SV=3 4 403 1.0E-135
sp|Q0IFL5|ASSY_AEDAE Argininosuccinate synthase OS=Aedes aegypti GN=AAEL004701 PE=3 SV=1 1 403 2.0E-132
sp|A8F446|ASSY_PSELT Argininosuccinate synthase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=argG PE=3 SV=1 7 403 1.0E-127
sp|O97069|ASSY_DROME Argininosuccinate synthase OS=Drosophila melanogaster GN=CG1315 PE=2 SV=1 5 403 6.0E-123
sp|Q6AR59|ASSY_DESPS Argininosuccinate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argG PE=3 SV=1 4 401 7.0E-114
sp|B8DN64|ASSY_DESVM Argininosuccinate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=argG PE=3 SV=1 1 410 1.0E-110
sp|A7GYN4|ASSY_CAMC5 Argininosuccinate synthase OS=Campylobacter curvus (strain 525.92) GN=argG PE=3 SV=2 7 400 3.0E-109
sp|A6Q3P9|ASSY_NITSB Argininosuccinate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=argG PE=3 SV=1 1 400 1.0E-108
sp|Q30YB8|ASSY_DESAG Argininosuccinate synthase OS=Desulfovibrio alaskensis (strain G20) GN=argG PE=3 SV=1 7 406 2.0E-108
sp|A0LEB2|ASSY_SYNFM Argininosuccinate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=argG PE=3 SV=1 7 401 4.0E-108
sp|B5ED13|ASSY_GEOBB Argininosuccinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=argG PE=3 SV=1 7 401 9.0E-108
sp|C6E6Y6|ASSY_GEOSM Argininosuccinate synthase OS=Geobacter sp. (strain M21) GN=argG PE=3 SV=1 7 401 1.0E-107
sp|P61522|ASSY_DESVH Argininosuccinate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argG PE=3 SV=1 1 403 8.0E-107
sp|B8FH30|ASSY_DESAA Argininosuccinate synthase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=argG PE=3 SV=1 7 401 9.0E-107
sp|A1VEQ0|ASSY_DESVV Argininosuccinate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argG PE=3 SV=1 1 403 3.0E-106
sp|B0SJR2|ASSY_LEPBP Argininosuccinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=argG PE=3 SV=1 7 405 2.0E-105
sp|B0S9J6|ASSY_LEPBA Argininosuccinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=argG PE=3 SV=1 7 405 2.0E-105
sp|A0RP84|ASSY_CAMFF Argininosuccinate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=argG PE=3 SV=1 7 400 2.0E-105
sp|Q1QHE6|ASSY_NITHX Argininosuccinate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=argG PE=3 SV=1 7 411 2.0E-105
sp|A5V0J9|ASSY_ROSS1 Argininosuccinate synthase OS=Roseiflexus sp. (strain RS-1) GN=argG PE=3 SV=1 1 401 3.0E-105
sp|Q056F0|ASSY_LEPBL Argininosuccinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=argG PE=3 SV=1 1 398 3.0E-105
sp|Q04P84|ASSY_LEPBJ Argininosuccinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=argG PE=3 SV=1 1 398 3.0E-105
sp|P61524|ASSY_LEPIC Argininosuccinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argG PE=3 SV=1 7 398 5.0E-105
sp|A1ATU4|ASSY_PELPD Argininosuccinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=argG PE=3 SV=1 8 401 6.0E-105
sp|Q8EYP7|ASSY_LEPIN Argininosuccinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argG PE=3 SV=1 7 398 6.0E-105
sp|A7ZDF2|ASSY_CAMC1 Argininosuccinate synthase OS=Campylobacter concisus (strain 13826) GN=argG PE=3 SV=1 7 400 3.0E-104
sp|Q1IIZ2|ASSY_KORVE Argininosuccinate synthase OS=Koribacter versatilis (strain Ellin345) GN=argG PE=3 SV=1 7 395 3.0E-104
sp|A7NPB0|ASSY_ROSCS Argininosuccinate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=argG PE=3 SV=1 1 401 4.0E-104
sp|P59846|ASSY_THET8 Argininosuccinate synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argG PE=1 SV=1 7 401 7.0E-104
sp|P61523|ASSY_GEOSL Argininosuccinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argG PE=3 SV=1 7 401 7.0E-104
sp|Q11D10|ASSY_CHESB Argininosuccinate synthase OS=Chelativorans sp. (strain BNC1) GN=argG PE=3 SV=2 7 407 8.0E-104
sp|A7I281|ASSY_CAMHC Argininosuccinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=argG PE=3 SV=1 1 400 9.0E-104
sp|Q39Z72|ASSY_GEOMG Argininosuccinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argG PE=3 SV=1 7 401 1.0E-103
sp|P61526|ASSY_THET2 Argininosuccinate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argG PE=3 SV=1 7 401 2.0E-103
sp|Q2LT97|ASSY_SYNAS Argininosuccinate synthase OS=Syntrophus aciditrophicus (strain SB) GN=argG PE=3 SV=1 7 407 1.0E-102
sp|Q31H63|ASSY_THICR Argininosuccinate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=argG PE=3 SV=1 7 407 1.0E-102
sp|B9M374|ASSY_GEODF Argininosuccinate synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=argG PE=3 SV=1 7 401 2.0E-102
sp|Q3A1V1|ASSY_PELCD Argininosuccinate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=argG PE=3 SV=1 3 411 2.0E-102
sp|A5GDA4|ASSY_GEOUR Argininosuccinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=argG PE=3 SV=1 7 401 2.0E-102
sp|Q5NNQ0|ASSY_ZYMMO Argininosuccinate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=argG PE=3 SV=1 7 409 4.0E-102
sp|Q2YA75|ASSY_NITMU Argininosuccinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=argG PE=3 SV=1 7 401 5.0E-102
sp|A8LPE0|ASSY_DINSH Argininosuccinate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=argG PE=3 SV=1 7 401 6.0E-102
sp|Q1QVN0|ASSY_CHRSD Argininosuccinate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argG PE=3 SV=1 7 401 9.0E-102
sp|Q3SNT5|ASSY_NITWN Argininosuccinate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=argG PE=3 SV=1 1 411 1.0E-101
sp|Q30QT1|ASSY_SULDN Argininosuccinate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=argG PE=3 SV=1 7 409 2.0E-101
sp|Q1IWM3|ASSY_DEIGD Argininosuccinate synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=argG PE=3 SV=1 3 401 2.0E-101
sp|Q5HVA9|ASSY_CAMJR Argininosuccinate synthase OS=Campylobacter jejuni (strain RM1221) GN=argG PE=3 SV=1 1 400 2.0E-101
sp|Q1MQL7|ASSY_LAWIP Argininosuccinate synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argG PE=3 SV=1 1 403 3.0E-101
sp|A7H4E9|ASSY_CAMJD Argininosuccinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=argG PE=3 SV=1 7 400 5.0E-101
sp|B0T3Z9|ASSY_CAUSK Argininosuccinate synthase OS=Caulobacter sp. (strain K31) GN=argG PE=3 SV=1 7 401 6.0E-101
sp|A1VZ24|ASSY_CAMJJ Argininosuccinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=argG PE=3 SV=1 7 400 6.0E-101
sp|Q7VGU9|ASSY_HELHP Argininosuccinate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=argG PE=3 SV=1 1 400 9.0E-101
sp|A8FL83|ASSY_CAMJ8 Argininosuccinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=argG PE=3 SV=1 7 400 9.0E-101
sp|A8EUB2|ASSY_ARCB4 Argininosuccinate synthase OS=Arcobacter butzleri (strain RM4018) GN=argG PE=3 SV=1 7 409 1.0E-100
sp|Q1GVV6|ASSY_SPHAL Argininosuccinate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=argG PE=3 SV=1 1 406 2.0E-100
sp|Q7NWJ5|ASSY_CHRVO Argininosuccinate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argG PE=3 SV=1 7 411 2.0E-100
sp|Q16D10|ASSY_ROSDO Argininosuccinate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=argG PE=3 SV=1 7 401 3.0E-100
sp|P59602|ASSY_CLOTE Argininosuccinate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=argG PE=3 SV=1 4 395 4.0E-100
sp|Q9PHK7|ASSY_CAMJE Argininosuccinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argG PE=1 SV=1 7 400 5.0E-100
sp|Q609X7|ASSY_METCA Argininosuccinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argG PE=3 SV=1 7 406 5.0E-100
sp|Q82UP5|ASSY_NITEU Argininosuccinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argG PE=3 SV=1 7 401 6.0E-100
sp|Q0VRM5|ASSY_ALCBS Argininosuccinate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=argG PE=3 SV=1 7 401 9.0E-100
sp|C1CXR6|ASSY_DEIDV Argininosuccinate synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=argG PE=3 SV=1 4 412 2.0E-99
sp|Q9RWJ4|ASSY_DEIRA Argininosuccinate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argG PE=3 SV=1 4 410 2.0E-99
sp|B0CII7|ASSY_BRUSI Argininosuccinate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|A5VN19|ASSY_BRUO2 Argininosuccinate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|Q8YEK8|ASSY_BRUME Argininosuccinate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|C0RGD6|ASSY_BRUMB Argininosuccinate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|A9M6S7|ASSY_BRUC2 Argininosuccinate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|Q57FU2|ASSY_BRUAB Argininosuccinate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|Q2YPQ8|ASSY_BRUA2 Argininosuccinate synthase OS=Brucella abortus (strain 2308) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|B2S7X3|ASSY_BRUA1 Argininosuccinate synthase OS=Brucella abortus (strain S19) GN=argG PE=3 SV=1 7 401 4.0E-99
sp|Q2N9H9|ASSY_ERYLH Argininosuccinate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=argG PE=3 SV=1 7 406 5.0E-99
sp|A6QAX6|ASSY_SULNB Argininosuccinate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=argG PE=3 SV=1 7 407 5.0E-99
sp|A5WG08|ASSY_PSYWF Argininosuccinate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=argG PE=3 SV=1 7 400 7.0E-99
sp|B8ESL2|ASSY_METSB Argininosuccinate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=argG PE=3 SV=1 7 409 8.0E-99
sp|Q3A9W5|ASSY_CARHZ Argininosuccinate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argG PE=3 SV=1 7 401 9.0E-99
sp|Q7M7P6|ASSY_WOLSU Argininosuccinate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argG PE=3 SV=1 1 400 1.0E-98
sp|C3KBZ2|ASSY_PSEFS Argininosuccinate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=argG PE=3 SV=1 7 401 1.0E-98
sp|A1AVI7|ASSY_RUTMC Argininosuccinate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argG PE=3 SV=1 7 401 2.0E-98
sp|B8FWX2|ASSY_DESHD Argininosuccinate synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=argG PE=3 SV=1 7 411 2.0E-98
sp|Q0AEE4|ASSY_NITEC Argininosuccinate synthase OS=Nitrosomonas eutropha (strain C91) GN=argG PE=3 SV=1 7 401 2.0E-98
sp|Q8G376|ASSY_BRUSU Argininosuccinate synthase OS=Brucella suis biovar 1 (strain 1330) GN=argG PE=3 SV=1 7 401 3.0E-98
sp|Q1GCK1|ASSY_RUEST Argininosuccinate synthase OS=Ruegeria sp. (strain TM1040) GN=argG PE=3 SV=1 7 401 4.0E-98
sp|B9KG97|ASSY_CAMLR Argininosuccinate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=argG PE=3 SV=1 7 400 4.0E-98
sp|B4S7R9|ASSY_PROA2 Argininosuccinate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argG PE=3 SV=1 4 407 4.0E-98
sp|Q24ZG8|ASSY_DESHY Argininosuccinate synthase OS=Desulfitobacterium hafniense (strain Y51) GN=argG PE=3 SV=1 7 411 4.0E-98
sp|A7IGW4|ASSY_XANP2 Argininosuccinate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=argG PE=3 SV=1 1 412 4.0E-98
sp|B9KPT5|ASSY_RHOSK Argininosuccinate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=argG PE=3 SV=1 7 401 5.0E-98
sp|Q3IYJ1|ASSY_RHOS4 Argininosuccinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argG PE=3 SV=1 7 401 5.0E-98
sp|A3PNQ9|ASSY_RHOS1 Argininosuccinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argG PE=3 SV=1 7 401 5.0E-98
sp|A6WV13|ASSY_OCHA4 Argininosuccinate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=argG PE=3 SV=2 7 401 5.0E-98
sp|Q2RMV0|ASSY_RHORT Argininosuccinate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=argG PE=3 SV=2 3 401 5.0E-98
sp|Q3K7K0|ASSY_PSEPF Argininosuccinate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=argG PE=3 SV=1 7 401 5.0E-98
sp|A1BG29|ASSY_CHLPD Argininosuccinate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=argG PE=3 SV=1 4 405 6.0E-98
sp|Q0BWI1|ASSY_HYPNA Argininosuccinate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=argG PE=3 SV=1 2 393 6.0E-98
sp|Q1Q9L2|ASSY_PSYCK Argininosuccinate synthase OS=Psychrobacter cryohalolentis (strain K5) GN=argG PE=3 SV=1 7 400 7.0E-98
sp|Q21HZ6|ASSY_SACD2 Argininosuccinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argG PE=3 SV=1 7 406 8.0E-98
sp|Q3ASI2|ASSY_CHLCH Argininosuccinate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=argG PE=3 SV=1 4 405 8.0E-98
sp|Q9ABU1|ASSY_CAUCR Argininosuccinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argG PE=3 SV=1 7 401 9.0E-98
sp|B8GXL9|ASSY_CAUCN Argininosuccinate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=argG PE=3 SV=1 7 401 9.0E-98
sp|Q0BVJ1|ASSY_GRABC Argininosuccinate synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=argG PE=3 SV=1 7 401 9.0E-98
sp|A4VIU7|ASSY_PSEU5 Argininosuccinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=argG PE=3 SV=1 7 401 1.0E-97
sp|B6IVD0|ASSY_RHOCS Argininosuccinate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=argG PE=3 SV=1 1 401 1.0E-97
sp|B3ECP2|ASSY_CHLL2 Argininosuccinate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=argG PE=3 SV=1 4 405 1.0E-97
sp|A5FWI5|ASSY_ACICJ Argininosuccinate synthase OS=Acidiphilium cryptum (strain JF-5) GN=argG PE=3 SV=1 7 401 1.0E-97
sp|Q4K749|ASSY_PSEF5 Argininosuccinate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argG PE=3 SV=1 7 401 1.0E-97
sp|A5VAK5|ASSY_SPHWW Argininosuccinate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=argG PE=3 SV=1 7 397 1.0E-97
sp|Q92L73|ASSY_RHIME Argininosuccinate synthase OS=Rhizobium meliloti (strain 1021) GN=argG PE=3 SV=1 7 401 2.0E-97
sp|Q4FR79|ASSY_PSYA2 Argininosuccinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=argG PE=3 SV=1 7 400 2.0E-97
sp|A1U3U4|ASSY_MARHV Argininosuccinate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argG PE=3 SV=1 7 401 2.0E-97
sp|Q4FNX4|ASSY_PELUB Argininosuccinate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=argG PE=3 SV=1 4 401 2.0E-97
sp|A5CXM9|ASSY_VESOH Argininosuccinate synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=argG PE=3 SV=1 4 400 2.0E-97
sp|A1AZB7|ASSY_PARDP Argininosuccinate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=argG PE=3 SV=1 1 401 2.0E-97
sp|A6UE09|ASSY_SINMW Argininosuccinate synthase OS=Sinorhizobium medicae (strain WSM419) GN=argG PE=3 SV=1 7 401 2.0E-97
sp|Q9HY84|ASSY_PSEAE Argininosuccinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argG PE=3 SV=1 7 401 3.0E-97
sp|Q02QZ6|ASSY_PSEAB Argininosuccinate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argG PE=3 SV=1 7 401 3.0E-97
sp|B7UVV5|ASSY_PSEA8 Argininosuccinate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=argG PE=3 SV=1 7 401 3.0E-97
sp|Q98E81|ASSY_RHILO Argininosuccinate synthase OS=Rhizobium loti (strain MAFF303099) GN=argG PE=3 SV=1 7 401 3.0E-97
sp|A4XS43|ASSY_PSEMY Argininosuccinate synthase OS=Pseudomonas mendocina (strain ymp) GN=argG PE=3 SV=1 7 401 3.0E-97
sp|Q3J9C8|ASSY_NITOC Argininosuccinate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=argG PE=3 SV=1 7 401 4.0E-97
sp|A4WVX3|ASSY_RHOS5 Argininosuccinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argG PE=3 SV=1 7 401 5.0E-97
sp|Q1MAN9|ASSY2_RHIL3 Argininosuccinate synthase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argG2 PE=3 SV=1 7 408 9.0E-97
sp|A6V1S1|ASSY_PSEA7 Argininosuccinate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=argG PE=3 SV=1 7 401 1.0E-96
sp|Q1MEZ8|ASSY1_RHIL3 Argininosuccinate synthase 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=argG1 PE=3 SV=1 7 407 1.0E-96
sp|Q2K3B7|ASSY_RHIEC Argininosuccinate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=argG PE=3 SV=1 7 408 1.0E-96
sp|A6VVI2|ASSY_MARMS Argininosuccinate synthase OS=Marinomonas sp. (strain MWYL1) GN=argG PE=3 SV=1 7 406 1.0E-96
sp|Q0AB32|ASSY_ALKEH Argininosuccinate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=argG PE=3 SV=1 7 401 1.0E-96
sp|Q5FUA8|ASSY_GLUOX Argininosuccinate synthase OS=Gluconobacter oxydans (strain 621H) GN=argG PE=3 SV=1 7 405 2.0E-96
sp|C1D9Q4|ASSY_LARHH Argininosuccinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=argG PE=3 SV=1 7 401 2.0E-96
sp|B2SY63|ASSY_BURPP Argininosuccinate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=argG PE=3 SV=1 7 401 2.0E-96
sp|A8IQ54|ASSY_AZOC5 Argininosuccinate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=argG PE=3 SV=1 7 401 3.0E-96
sp|Q0AKJ6|ASSY_MARMM Argininosuccinate synthase OS=Maricaulis maris (strain MCS10) GN=argG PE=3 SV=1 7 411 3.0E-96
sp|Q13UR1|ASSY_BURXL Argininosuccinate synthase OS=Burkholderia xenovorans (strain LB400) GN=argG PE=3 SV=1 7 401 5.0E-96
sp|Q5HBF2|ASSY_EHRRW Argininosuccinate synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=argG PE=3 SV=1 7 402 5.0E-96
sp|B4S9U5|ASSY_PELPB Argininosuccinate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=argG PE=3 SV=1 4 405 6.0E-96
sp|A7HSW4|ASSY_PARL1 Argininosuccinate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=argG PE=3 SV=1 7 393 6.0E-96
sp|A9IL50|ASSY_BART1 Argininosuccinate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=argG PE=3 SV=1 7 401 9.0E-96
sp|Q28WC8|ASSY_JANSC Argininosuccinate synthase OS=Jannaschia sp. (strain CCS1) GN=argG PE=3 SV=1 7 401 1.0E-95
sp|A1K7J8|ASSY_AZOSB Argininosuccinate synthase OS=Azoarcus sp. (strain BH72) GN=argG PE=3 SV=1 7 411 1.0E-95
sp|B3QN91|ASSY_CHLP8 Argininosuccinate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argG PE=3 SV=1 4 405 2.0E-95
sp|Q48F14|ASSY_PSE14 Argininosuccinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argG PE=3 SV=1 7 401 3.0E-95
sp|Q9SZX3|ASSY_ARATH Argininosuccinate synthase, chloroplastic OS=Arabidopsis thaliana GN=At4g24830 PE=1 SV=3 1 401 3.0E-95
sp|B3EJ62|ASSY_CHLPB Argininosuccinate synthase OS=Chlorobium phaeobacteroides (strain BS1) GN=argG PE=3 SV=1 7 405 3.0E-95
sp|Q4ZPK0|ASSY_PSEU2 Argininosuccinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argG PE=3 SV=1 7 401 5.0E-95
sp|Q8UC31|ASSY_AGRFC Argininosuccinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argG PE=3 SV=2 7 408 7.0E-95
sp|A4J173|ASSY_DESRM Argininosuccinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=argG PE=3 SV=1 7 411 9.0E-95
sp|Q2W896|ASSY_MAGSA Argininosuccinate synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=argG PE=3 SV=1 1 401 1.0E-94
sp|Q2SCE5|ASSY_HAHCH Argininosuccinate synthase OS=Hahella chejuensis (strain KCTC 2396) GN=argG PE=3 SV=1 7 401 1.0E-94
sp|A4SEI8|ASSY_CHLPM Argininosuccinate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=argG PE=3 SV=1 5 405 1.0E-94
sp|Q8R7C2|ASSY_CALS4 Argininosuccinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argG PE=3 SV=1 7 401 1.0E-94
sp|A4SZQ2|ASSY_POLSQ Argininosuccinate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=argG PE=3 SV=1 7 401 2.0E-94
sp|Q87XM3|ASSY_PSESM Argininosuccinate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argG PE=3 SV=1 7 401 2.0E-94
sp|Q5LWG3|ASSY_RUEPO Argininosuccinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=argG PE=3 SV=1 7 401 2.0E-94
sp|Q5FH27|ASSY_EHRRG Argininosuccinate synthase OS=Ehrlichia ruminantium (strain Gardel) GN=argG PE=3 SV=1 7 402 3.0E-94
sp|B9MRP5|ASSY_CALBD Argininosuccinate synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=argG PE=3 SV=1 7 412 3.0E-94
sp|B2VGA8|ASSY_ERWT9 Argininosuccinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argG PE=3 SV=1 7 407 3.0E-94
sp|Q5P0Z7|ASSY_AROAE Argininosuccinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=argG PE=3 SV=1 7 411 4.0E-94
sp|B0KUE7|ASSY_PSEPG Argininosuccinate synthase OS=Pseudomonas putida (strain GB-1) GN=argG PE=3 SV=1 7 401 5.0E-94
sp|A1UUF5|ASSY_BARBK Argininosuccinate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=argG PE=3 SV=1 7 401 6.0E-94
sp|B1J4I4|ASSY_PSEPW Argininosuccinate synthase OS=Pseudomonas putida (strain W619) GN=argG PE=3 SV=1 7 401 7.0E-94
sp|Q186Z6|ASSY_PEPD6 Argininosuccinate synthase OS=Peptoclostridium difficile (strain 630) GN=argG PE=3 SV=1 5 401 8.0E-94
sp|Q1H0L1|ASSY_METFK Argininosuccinate synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=argG PE=3 SV=1 7 401 8.0E-94
sp|P59412|ASSY_BUCBP Argininosuccinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argG PE=3 SV=1 7 398 1.0E-93
sp|B0KBW5|ASSY_THEP3 Argininosuccinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=argG PE=3 SV=1 7 401 1.0E-93
sp|B0K4D8|ASSY_THEPX Argininosuccinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=argG PE=3 SV=1 7 401 1.0E-93
sp|P59604|ASSY_PSEPK Argininosuccinate synthase OS=Pseudomonas putida (strain KT2440) GN=argG PE=3 SV=1 7 401 1.0E-93
sp|A5VZI0|ASSY_PSEP1 Argininosuccinate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=argG PE=3 SV=1 7 401 1.0E-93
sp|Q1IE03|ASSY_PSEE4 Argininosuccinate synthase OS=Pseudomonas entomophila (strain L48) GN=argG PE=3 SV=1 7 401 1.0E-93
sp|Q8XMJ7|ASSY_CLOPE Argininosuccinate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=argG PE=3 SV=1 7 395 2.0E-93
sp|Q2G933|ASSY_NOVAD Argininosuccinate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=argG PE=3 SV=1 7 393 2.0E-93
sp|B1KND6|ASSY_SHEWM Argininosuccinate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argG PE=3 SV=1 7 398 3.0E-93
sp|Q8KDE0|ASSY_CHLTE Argininosuccinate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argG PE=3 SV=1 4 403 3.0E-93
sp|Q0TTA5|ASSY_CLOP1 Argininosuccinate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=argG PE=3 SV=1 7 395 4.0E-93
sp|Q3B425|ASSY_CHLL7 Argininosuccinate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=argG PE=3 SV=1 7 405 4.0E-93
sp|C1DQV2|ASSY_AZOVD Argininosuccinate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argG PE=3 SV=1 7 401 6.0E-93
sp|Q47BM0|ASSY_DECAR Argininosuccinate synthase OS=Dechloromonas aromatica (strain RCB) GN=argG PE=3 SV=1 7 401 8.0E-93
sp|A1WUZ5|ASSY_HALHL Argininosuccinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argG PE=3 SV=1 7 401 1.0E-92
sp|Q15X83|ASSY_PSEA6 Argininosuccinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argG PE=3 SV=1 7 398 1.0E-92
sp|B1XRS6|ASSY_POLNS Argininosuccinate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=argG PE=3 SV=1 7 401 2.0E-92
sp|A0LE34|ASSY_MAGMM Argininosuccinate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argG PE=3 SV=1 1 401 2.0E-92
sp|A3DBU1|ASSY_CLOTH Argininosuccinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argG PE=3 SV=1 5 401 3.0E-92
sp|A8GL82|ASSY_SERP5 Argininosuccinate synthase OS=Serratia proteamaculans (strain 568) GN=argG PE=3 SV=1 7 410 5.0E-92
sp|B2TQ23|ASSY_CLOBB Argininosuccinate synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=argG PE=3 SV=1 7 411 5.0E-92
sp|B2UYI0|ASSY_CLOBA Argininosuccinate synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argG PE=3 SV=1 7 410 8.0E-92
sp|Q3SHT1|ASSY_THIDA Argininosuccinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argG PE=3 SV=2 7 401 1.0E-91
sp|A5D510|ASSY_PELTS Argininosuccinate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=argG PE=3 SV=1 7 401 1.0E-91
sp|B0TL85|ASSY_SHEHH Argininosuccinate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argG PE=3 SV=1 2 407 1.0E-91
sp|A8G1A4|ASSY_SHESH Argininosuccinate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=argG PE=3 SV=1 7 398 1.0E-91
sp|A9HIQ4|ASSY_GLUDA Argininosuccinate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=argG PE=3 SV=1 7 405 2.0E-91
sp|Q9K4Z3|ASSY_MORPR Argininosuccinate synthase OS=Moritella profunda GN=argG PE=3 SV=1 1 398 2.0E-91
sp|A5N6U2|ASSY_CLOK5 Argininosuccinate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argG PE=3 SV=1 5 401 4.0E-91
sp|B9E0B1|ASSY_CLOK1 Argininosuccinate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=argG PE=3 SV=1 5 401 4.0E-91
sp|A0Q1Z2|ASSY_CLONN Argininosuccinate synthase OS=Clostridium novyi (strain NT) GN=argG PE=3 SV=1 5 412 4.0E-91
sp|A8GZ21|ASSY_SHEPA Argininosuccinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argG PE=3 SV=1 7 407 5.0E-91
sp|A4XKG4|ASSY_CALS8 Argininosuccinate synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=argG PE=3 SV=1 7 412 7.0E-91
sp|A3Q9C9|ASSY_SHELP Argininosuccinate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=argG PE=3 SV=1 7 398 7.0E-91
sp|Q7UFW4|ASSY_RHOBA Argininosuccinate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argG PE=3 SV=2 10 405 1.0E-90
sp|Q489P3|ASSY_COLP3 Argininosuccinate synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=argG PE=3 SV=1 7 393 1.0E-90
sp|Q05FN6|ASSY_CARRP Argininosuccinate synthase OS=Carsonella ruddii (strain PV) GN=argG PE=3 SV=1 5 400 1.0E-90
sp|A1S264|ASSY_SHEAM Argininosuccinate synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=argG PE=3 SV=1 7 406 2.0E-90
sp|A6WTS0|ASSY_SHEB8 Argininosuccinate synthase OS=Shewanella baltica (strain OS185) GN=argG PE=3 SV=1 7 409 3.0E-90
sp|A3DA23|ASSY_SHEB5 Argininosuccinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argG PE=3 SV=1 7 409 3.0E-90
sp|B8EBG0|ASSY_SHEB2 Argininosuccinate synthase OS=Shewanella baltica (strain OS223) GN=argG PE=3 SV=1 7 409 3.0E-90
sp|Q2RG67|ASSY_MOOTA Argininosuccinate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=argG PE=3 SV=1 7 401 4.0E-90
sp|Q8KA60|ASSY_BUCAP Argininosuccinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argG PE=3 SV=1 7 409 5.0E-90
sp|B8CNI0|ASSY_SHEPW Argininosuccinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argG PE=3 SV=1 7 398 6.0E-90
sp|Q058D6|ASSY_BUCCC Argininosuccinate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=argG PE=3 SV=1 5 395 1.0E-89
sp|Q5QWZ9|ASSY_IDILO Argininosuccinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=argG PE=3 SV=1 7 411 2.0E-89
sp|Q7MH72|ASSY_VIBVY Argininosuccinate synthase OS=Vibrio vulnificus (strain YJ016) GN=argG PE=3 SV=2 7 407 3.0E-89
sp|Q8DCN0|ASSY_VIBVU Argininosuccinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=argG PE=3 SV=2 7 407 3.0E-89
sp|B8D6W2|ASSY_BUCAT Argininosuccinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argG PE=3 SV=1 7 409 3.0E-89
sp|P57158|ASSY_BUCAI Argininosuccinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argG PE=3 SV=1 7 409 3.0E-89
sp|B8D8K8|ASSY_BUCA5 Argininosuccinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argG PE=3 SV=1 7 409 3.0E-89
sp|A9KTY7|ASSY_SHEB9 Argininosuccinate synthase OS=Shewanella baltica (strain OS195) GN=argG PE=3 SV=1 7 409 4.0E-89
sp|Q97KE6|ASSY_CLOAB Argininosuccinate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argG PE=3 SV=1 5 409 6.0E-89
sp|A1RPR6|ASSY_SHESW Argininosuccinate synthase OS=Shewanella sp. (strain W3-18-1) GN=argG PE=3 SV=1 7 398 8.0E-89
sp|A4YBT9|ASSY_SHEPC Argininosuccinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=argG PE=3 SV=1 7 398 8.0E-89
sp|A7ML85|ASSY_CROS8 Argininosuccinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argG PE=3 SV=1 7 395 1.0E-88
sp|Q3YS95|ASSY_EHRCJ Argininosuccinate synthase OS=Ehrlichia canis (strain Jake) GN=argG PE=3 SV=1 7 401 1.0E-88
sp|Q8GDU2|ASSY_HELMO Argininosuccinate synthase (Fragment) OS=Heliobacillus mobilis GN=argG PE=3 SV=1 3 411 2.0E-88
sp|A5I5A4|ASSY_CLOBH Argininosuccinate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=argG PE=3 SV=1 5 395 2.0E-88
sp|A7FWU6|ASSY_CLOB1 Argininosuccinate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=argG PE=3 SV=1 5 395 2.0E-88
sp|A6M1Z4|ASSY_CLOB8 Argininosuccinate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argG PE=3 SV=1 7 412 3.0E-88
sp|A7GGQ9|ASSY_CLOBL Argininosuccinate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=argG PE=3 SV=1 5 395 3.0E-88
sp|A6TL10|ASSY_ALKMQ Argininosuccinate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argG PE=3 SV=1 4 400 6.0E-88
sp|A1SRI3|ASSY_PSYIN Argininosuccinate synthase OS=Psychromonas ingrahamii (strain 37) GN=argG PE=3 SV=1 7 407 9.0E-88
sp|C3L1U3|ASSY_CLOB6 Argininosuccinate synthase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=argG PE=3 SV=1 5 395 1.0E-87
sp|C4Z4C1|ASSY_EUBE2 Argininosuccinate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=argG PE=3 SV=1 5 410 1.0E-87
sp|B5FBP4|ASSY_VIBFM Argininosuccinate synthase OS=Vibrio fischeri (strain MJ11) GN=argG PE=3 SV=1 11 398 1.0E-87
sp|B1KXY1|ASSY_CLOBM Argininosuccinate synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=argG PE=3 SV=1 5 395 1.0E-87
sp|B1IK08|ASSY_CLOBK Argininosuccinate synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=argG PE=3 SV=1 5 395 1.0E-87
sp|P59605|ASSY_VIBPA Argininosuccinate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argG PE=3 SV=1 11 407 1.0E-87
sp|C1FU68|ASSY_CLOBJ Argininosuccinate synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=argG PE=3 SV=1 5 395 1.0E-87
sp|B6EMN8|ASSY_ALISL Argininosuccinate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=argG PE=3 SV=1 11 398 1.0E-87
sp|Q0I061|ASSY_SHESR Argininosuccinate synthase OS=Shewanella sp. (strain MR-7) GN=argG PE=3 SV=1 7 398 1.0E-87
sp|Q0HDU8|ASSY_SHESM Argininosuccinate synthase OS=Shewanella sp. (strain MR-4) GN=argG PE=3 SV=1 7 398 1.0E-87
sp|A0L251|ASSY_SHESA Argininosuccinate synthase OS=Shewanella sp. (strain ANA-3) GN=argG PE=3 SV=1 7 398 1.0E-87
sp|Q8EK28|ASSY_SHEON Argininosuccinate synthase OS=Shewanella oneidensis (strain MR-1) GN=argG PE=3 SV=1 7 398 2.0E-87
sp|Q5E2E7|ASSY_VIBF1 Argininosuccinate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argG PE=3 SV=1 11 398 2.0E-87
sp|A7MXB9|ASSY_VIBCB Argininosuccinate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argG PE=3 SV=1 11 407 4.0E-87
sp|C3LRV3|ASSY_VIBCM Argininosuccinate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=argG PE=3 SV=1 11 407 4.0E-87
sp|Q9KNT8|ASSY_VIBCH Argininosuccinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argG PE=3 SV=1 11 407 4.0E-87
sp|A5F4Z4|ASSY_VIBC3 Argininosuccinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=argG PE=3 SV=1 11 407 4.0E-87
sp|Q7MYD8|ASSY_PHOLL Argininosuccinate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argG PE=3 SV=1 7 398 6.0E-87
sp|Q1WV65|ASSY_LACS1 Argininosuccinate synthase OS=Lactobacillus salivarius (strain UCC118) GN=argG PE=3 SV=1 5 405 1.0E-86
sp|B2J6U2|ASSY_NOSP7 Argininosuccinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argG PE=3 SV=1 3 406 1.0E-86
sp|Q7U3B9|ASSY_SYNPX Argininosuccinate synthase OS=Synechococcus sp. (strain WH8102) GN=argG PE=3 SV=1 3 411 2.0E-86
sp|B7JS06|ASSY_BACC0 Argininosuccinate synthase OS=Bacillus cereus (strain AH820) GN=argG PE=3 SV=1 5 405 3.0E-86
sp|Q6HCP7|ASSY_BACHK Argininosuccinate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argG PE=3 SV=1 5 405 3.0E-86
sp|Q81KV7|ASSY_BACAN Argininosuccinate synthase OS=Bacillus anthracis GN=argG PE=3 SV=1 5 405 3.0E-86
sp|C3L9T6|ASSY_BACAC Argininosuccinate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argG PE=3 SV=1 5 405 3.0E-86
sp|C3PB97|ASSY_BACAA Argininosuccinate synthase OS=Bacillus anthracis (strain A0248) GN=argG PE=3 SV=1 5 405 3.0E-86
sp|Q633G4|ASSY_BACCZ Argininosuccinate synthase OS=Bacillus cereus (strain ZK / E33L) GN=argG PE=3 SV=1 5 405 4.0E-86
sp|C1EUX9|ASSY_BACC3 Argininosuccinate synthase OS=Bacillus cereus (strain 03BB102) GN=argG PE=3 SV=1 5 405 4.0E-86
sp|A0RJM4|ASSY_BACAH Argininosuccinate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=argG PE=3 SV=2 5 405 4.0E-86
sp|A9VKE1|ASSY_BACWK Argininosuccinate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argG PE=3 SV=1 5 405 5.0E-86
sp|Q3MBE6|ASSY_ANAVT Argininosuccinate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argG PE=3 SV=1 3 406 6.0E-86
sp|B1H0L3|ASSY_UNCTG Argininosuccinate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=argG PE=3 SV=1 7 401 9.0E-86
sp|C0Z6S0|ASSY_BREBN Argininosuccinate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=argG PE=3 SV=1 4 405 1.0E-85
sp|B9J0E1|ASSY_BACCQ Argininosuccinate synthase OS=Bacillus cereus (strain Q1) GN=argG PE=3 SV=1 5 405 1.0E-85
sp|P61520|ASSY_BACC1 Argininosuccinate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=argG PE=3 SV=1 5 405 2.0E-85
sp|B7HRS7|ASSY_BACC7 Argininosuccinate synthase OS=Bacillus cereus (strain AH187) GN=argG PE=3 SV=1 5 405 2.0E-85
sp|B1YJ35|ASSY_EXIS2 Argininosuccinate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argG PE=3 SV=1 4 411 4.0E-85
sp|Q2GGE6|ASSY_EHRCR Argininosuccinate synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=argG PE=3 SV=1 7 401 4.0E-85
sp|Q6LVG8|ASSY_PHOPR Argininosuccinate synthase OS=Photobacterium profundum GN=argG PE=3 SV=1 7 407 5.0E-85
sp|Q9K4Y8|ASSY_MORAB Argininosuccinate synthase OS=Moritella abyssi GN=argG PE=3 SV=1 1 378 6.0E-85
sp|Q817C6|ASSY_BACCR Argininosuccinate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argG PE=3 SV=1 5 405 6.0E-85
sp|B7H6Y5|ASSY_BACC4 Argininosuccinate synthase OS=Bacillus cereus (strain B4264) GN=argG PE=3 SV=1 5 405 6.0E-85
sp|B7IK29|ASSY_BACC2 Argininosuccinate synthase OS=Bacillus cereus (strain G9842) GN=argG PE=3 SV=1 5 405 7.0E-85
sp|Q9K820|ASSY_BACHD Argininosuccinate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argG PE=3 SV=1 4 403 8.0E-85
sp|Q3AVL9|ASSY_SYNS9 Argininosuccinate synthase OS=Synechococcus sp. (strain CC9902) GN=argG PE=3 SV=1 3 407 9.0E-85
sp|Q089K8|ASSY_SHEFN Argininosuccinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=argG PE=3 SV=1 10 398 1.0E-84
sp|O67213|ASSY_AQUAE Argininosuccinate synthase OS=Aquifex aeolicus (strain VF5) GN=argG PE=3 SV=1 5 405 1.0E-84
sp|Q8YMX6|ASSY_NOSS1 Argininosuccinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argG PE=3 SV=1 3 406 2.0E-84
sp|Q12SM7|ASSY_SHEDO Argininosuccinate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argG PE=3 SV=1 10 398 2.0E-84
sp|A2CE29|ASSY_PROM3 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=argG PE=3 SV=1 3 398 2.0E-83
sp|C5BC58|ASSY_EDWI9 Argininosuccinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=argG PE=3 SV=1 4 393 2.0E-83
sp|Q3IHT8|ASSY_PSEHT Argininosuccinate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=argG PE=3 SV=1 7 393 2.0E-83
sp|A9KHL4|ASSY_CLOPH Argininosuccinate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=argG PE=3 SV=1 5 401 4.0E-83
sp|P77973|ASSY_SYNY3 Argininosuccinate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argG PE=1 SV=1 3 406 1.0E-82
sp|C4Z9C9|ASSY_EUBR3 Argininosuccinate synthase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=argG PE=3 SV=1 5 401 1.0E-82
sp|Q117P0|ASSY_TRIEI Argininosuccinate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=argG PE=3 SV=1 7 406 1.0E-82
sp|B1WTK3|ASSY_CYAA5 Argininosuccinate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=argG PE=3 SV=1 3 406 2.0E-82
sp|Q5N1Z2|ASSY_SYNP6 Argininosuccinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argG PE=3 SV=1 3 405 2.0E-82
sp|Q31SC8|ASSY_SYNE7 Argininosuccinate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=argG PE=3 SV=1 3 405 2.0E-82
sp|A8AA65|ASSY_IGNH4 Argininosuccinate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=argG PE=3 SV=1 7 393 2.0E-82
sp|Q8ELT8|ASSY_OCEIH Argininosuccinate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argG PE=3 SV=1 4 395 2.0E-82
sp|B9DIU4|ASSY_STACT Argininosuccinate synthase OS=Staphylococcus carnosus (strain TM300) GN=argG PE=3 SV=1 5 398 3.0E-82
sp|Q3ZYG0|ASSY_DEHMC Argininosuccinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argG PE=3 SV=1 7 417 3.0E-82
sp|A5FQ73|ASSY_DEHMB Argininosuccinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=argG PE=3 SV=1 7 417 3.0E-82
sp|Q3Z727|ASSY_DEHM1 Argininosuccinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=argG PE=3 SV=1 7 417 3.0E-82
sp|Q67KE1|ASSY_SYMTH Argininosuccinate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=argG PE=3 SV=1 4 404 4.0E-82
sp|A7GTR5|ASSY_BACCN Argininosuccinate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=argG PE=3 SV=1 5 405 4.0E-82
sp|Q2JWE1|ASSY_SYNJA Argininosuccinate synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=argG PE=3 SV=1 3 405 4.0E-82
sp|Q49WA0|ASSY_STAS1 Argininosuccinate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argG PE=3 SV=1 5 401 6.0E-82
sp|B9DVV9|ASSY_STRU0 Argininosuccinate synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=argG PE=3 SV=1 4 395 2.0E-81
sp|B7JVH4|ASSY_CYAP8 Argininosuccinate synthase OS=Cyanothece sp. (strain PCC 8801) GN=argG PE=3 SV=1 3 406 2.0E-81
sp|Q7V3S9|ASSY_PROMM Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=argG PE=3 SV=1 3 395 2.0E-81
sp|Q7UZG0|ASSY_PROMP Argininosuccinate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argG PE=3 SV=1 7 405 3.0E-81
sp|Q0I607|ASSY_SYNS3 Argininosuccinate synthase OS=Synechococcus sp. (strain CC9311) GN=argG PE=3 SV=1 3 398 4.0E-81
sp|Q2JKS2|ASSY_SYNJB Argininosuccinate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=argG PE=3 SV=1 3 405 5.0E-81
sp|B1XN65|ASSY_SYNP2 Argininosuccinate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=argG PE=3 SV=1 3 405 5.0E-81
sp|B7GGR4|ASSY_ANOFW Argininosuccinate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=argG PE=3 SV=1 7 408 6.0E-81
sp|A5GPT0|ASSY_SYNPW Argininosuccinate synthase OS=Synechococcus sp. (strain WH7803) GN=argG PE=3 SV=1 3 403 6.0E-81
sp|A8FG70|ASSY_BACP2 Argininosuccinate synthase OS=Bacillus pumilus (strain SAFR-032) GN=argG PE=3 SV=1 7 401 6.0E-81
sp|Q4L4X7|ASSY_STAHJ Argininosuccinate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argG PE=3 SV=1 5 398 8.0E-81
sp|Q1AS35|ASSY_RUBXD Argininosuccinate synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=argG PE=3 SV=1 1 404 9.0E-81
sp|A9BDR3|ASSY_PROM4 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=argG PE=3 SV=1 7 409 9.0E-81
sp|Q8CPU3|ASSY_STAES Argininosuccinate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|Q5HQK0|ASSY_STAEQ Argininosuccinate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|A8Z067|ASSY_STAAT Argininosuccinate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|P63645|ASSY_STAAN Argininosuccinate synthase OS=Staphylococcus aureus (strain N315) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|P63644|ASSY_STAAM Argininosuccinate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|A6QFH2|ASSY_STAAE Argininosuccinate synthase OS=Staphylococcus aureus (strain Newman) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|Q5HHC4|ASSY_STAAC Argininosuccinate synthase OS=Staphylococcus aureus (strain COL) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|A5IRD9|ASSY_STAA9 Argininosuccinate synthase OS=Staphylococcus aureus (strain JH9) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|Q2FZU1|ASSY_STAA8 Argininosuccinate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|Q2FIB4|ASSY_STAA3 Argininosuccinate synthase OS=Staphylococcus aureus (strain USA300) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|A6U068|ASSY_STAA2 Argininosuccinate synthase OS=Staphylococcus aureus (strain JH1) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|A7X0H5|ASSY_STAA1 Argininosuccinate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argG PE=3 SV=1 5 398 1.0E-80
sp|Q8NXF2|ASSY_STAAW Argininosuccinate synthase OS=Staphylococcus aureus (strain MW2) GN=argG PE=3 SV=1 5 398 2.0E-80
sp|Q6GAW5|ASSY_STAAS Argininosuccinate synthase OS=Staphylococcus aureus (strain MSSA476) GN=argG PE=3 SV=1 5 398 2.0E-80
sp|Q65G67|ASSY_BACLD Argininosuccinate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argG PE=3 SV=1 5 401 2.0E-80
sp|A5GX16|ASSY_SYNR3 Argininosuccinate synthase OS=Synechococcus sp. (strain RCC307) GN=argG PE=3 SV=2 7 411 3.0E-80
sp|A0KFV3|ASSY_AERHH Argininosuccinate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=argG PE=3 SV=1 7 408 4.0E-80
sp|Q7NCP5|ASSY_GLOVI Argininosuccinate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=argG PE=3 SV=1 7 405 5.0E-80
sp|B0JM14|ASSY_MICAN Argininosuccinate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=argG PE=3 SV=1 3 406 5.0E-80
sp|A4IRS3|ASSY_GEOTN Argininosuccinate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=argG PE=3 SV=1 7 401 5.0E-80
sp|C5D679|ASSY_GEOSW Argininosuccinate synthase OS=Geobacillus sp. (strain WCH70) GN=argG PE=3 SV=1 7 403 5.0E-80
sp|A2BZ94|ASSY_PROM5 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=argG PE=3 SV=1 7 405 7.0E-80
sp|A3PFJ6|ASSY_PROM0 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=argG PE=3 SV=1 7 410 7.0E-80
sp|A4SIM5|ASSY_AERS4 Argininosuccinate synthase OS=Aeromonas salmonicida (strain A449) GN=argG PE=3 SV=1 7 408 1.0E-79
sp|B8HSA9|ASSY_CYAP4 Argininosuccinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=argG PE=3 SV=1 3 406 2.0E-79
sp|Q5KW94|ASSY_GEOKA Argininosuccinate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=argG PE=3 SV=1 7 401 2.0E-79
sp|Q03IP8|ASSY_STRTD Argininosuccinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argG PE=3 SV=1 4 395 2.0E-79
sp|Q5M2K2|ASSY_STRT2 Argininosuccinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argG PE=3 SV=2 4 395 2.0E-79
sp|Q5LXZ8|ASSY_STRT1 Argininosuccinate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argG PE=3 SV=2 4 395 2.0E-79
sp|Q6GIC7|ASSY_STAAR Argininosuccinate synthase OS=Staphylococcus aureus (strain MRSA252) GN=argG PE=3 SV=1 5 398 3.0E-79
sp|Q2YWS4|ASSY_STAAB Argininosuccinate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argG PE=3 SV=1 5 398 3.0E-79
sp|A4VXZ4|ASSY_STRSY Argininosuccinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=argG PE=3 SV=2 4 401 4.0E-79
sp|A4W488|ASSY_STRS2 Argininosuccinate synthase OS=Streptococcus suis (strain 98HAH33) GN=argG PE=3 SV=1 4 401 4.0E-79
sp|Q8U484|ASSY_PYRFU Argininosuccinate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argG PE=3 SV=1 7 395 5.0E-79
sp|Q3AG78|ASSY_SYNSC Argininosuccinate synthase OS=Synechococcus sp. (strain CC9605) GN=argG PE=3 SV=1 3 407 5.0E-79
sp|C0R1H5|ASSY_BRAHW Argininosuccinate synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=argG PE=3 SV=1 5 401 6.0E-79
sp|A2BTT9|ASSY_PROMS Argininosuccinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=argG PE=3 SV=1 7 410 2.0E-78
sp|B8E0N9|ASSY_DICTD Argininosuccinate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=argG PE=3 SV=1 7 395 2.0E-78
sp|Q8ZU97|ASSY_PYRAE Argininosuccinate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argG PE=3 SV=2 7 398 3.0E-78
sp|O34347|ASSY_BACSU Argininosuccinate synthase OS=Bacillus subtilis (strain 168) GN=argG PE=3 SV=1 7 401 4.0E-78
sp|A8G7L2|ASSY_PROM2 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=argG PE=3 SV=1 7 405 4.0E-78
sp|Q033U7|ASSY_LACC3 Argininosuccinate synthase OS=Lactobacillus casei (strain ATCC 334) GN=argG PE=3 SV=1 7 405 4.0E-78
sp|B5YAL9|ASSY_DICT6 Argininosuccinate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=argG PE=3 SV=1 5 395 1.0E-77
sp|Q8CWZ0|ASSY_STRMU Argininosuccinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argG PE=3 SV=1 4 395 2.0E-77
sp|Q317T4|ASSY_PROM9 Argininosuccinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=argG PE=3 SV=1 7 405 2.0E-77
sp|A8AUN6|ASSY_STRGC Argininosuccinate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=argG PE=3 SV=1 5 410 2.0E-77
sp|Q8DRI5|ASSY_STRR6 Argininosuccinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=argG PE=3 SV=2 4 405 6.0E-77
sp|Q04MW7|ASSY_STRP2 Argininosuccinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=argG PE=3 SV=1 4 405 6.0E-77
sp|B1I814|ASSY_STRPI Argininosuccinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=argG PE=3 SV=1 4 405 7.0E-77
sp|A7Z7M0|ASSY_BACMF Argininosuccinate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argG PE=3 SV=1 1 401 9.0E-77
sp|P59603|ASSY_LACPL Argininosuccinate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argG PE=3 SV=1 1 409 2.0E-76
sp|Q8DKY7|ASSY_THEEB Argininosuccinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=argG PE=3 SV=1 3 411 3.0E-76
sp|B2G6Y6|ASSY_LACRJ Argininosuccinate synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=argG PE=3 SV=1 4 404 3.0E-76
sp|A5VJH1|ASSY_LACRD Argininosuccinate synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=argG PE=3 SV=1 4 404 3.0E-76
sp|A3CQQ4|ASSY_STRSV Argininosuccinate synthase OS=Streptococcus sanguinis (strain SK36) GN=argG PE=3 SV=1 5 405 5.0E-76
sp|Q7V9F8|ASSY_PROMA Argininosuccinate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argG PE=3 SV=1 3 395 6.0E-76
sp|Q5WED8|ASSY_BACSK Argininosuccinate synthase OS=Bacillus clausii (strain KSM-K16) GN=argG PE=3 SV=1 4 401 6.0E-76
sp|B0CCQ2|ASSY_ACAM1 Argininosuccinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=argG PE=3 SV=1 3 407 6.0E-76
sp|Q5ZY78|ASSY_LEGPH Argininosuccinate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=argG PE=3 SV=1 7 405 7.0E-76
sp|Q63U95|ASSY_BURPS Argininosuccinate synthase OS=Burkholderia pseudomallei (strain K96243) GN=argG PE=3 SV=1 8 400 8.0E-76
sp|B8DH28|ASSY_LISMH Argininosuccinate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argG PE=3 SV=1 4 401 1.0E-75
sp|Q71XS4|ASSY_LISMF Argininosuccinate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argG PE=3 SV=1 4 401 1.0E-75
sp|C1KX43|ASSY_LISMC Argininosuccinate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argG PE=3 SV=1 4 401 1.0E-75
sp|A2C5I6|ASSY_PROM1 Argininosuccinate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=argG PE=3 SV=1 3 398 2.0E-75
sp|C1A051|ASSY_RHOE4 Argininosuccinate synthase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=argG PE=3 SV=1 7 401 2.0E-75
sp|Q46I72|ASSY_PROMT Argininosuccinate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=argG PE=3 SV=1 3 398 2.0E-75
sp|Q3K3Q4|ASSY_STRA1 Argininosuccinate synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=argG PE=3 SV=1 5 395 2.0E-75
sp|Q5X7P9|ASSY_LEGPA Argininosuccinate synthase OS=Legionella pneumophila (strain Paris) GN=argG PE=3 SV=1 7 405 2.0E-75
sp|Q8E272|ASSY_STRA5 Argininosuccinate synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=argG PE=3 SV=1 5 395 3.0E-75
sp|Q8E7N1|ASSY_STRA3 Argininosuccinate synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=argG PE=3 SV=1 5 395 4.0E-75
sp|A5IHA3|ASSY_LEGPC Argininosuccinate synthase OS=Legionella pneumophila (strain Corby) GN=argG PE=3 SV=1 7 405 8.0E-75
sp|Q59491|ASSY_LACLM Argininosuccinate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argG PE=3 SV=2 7 409 8.0E-75
sp|Q929S9|ASSY_LISIN Argininosuccinate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argG PE=3 SV=1 4 401 1.0E-74
sp|A0AKJ7|ASSY_LISW6 Argininosuccinate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argG PE=3 SV=1 4 401 2.0E-74
sp|Q5WZ50|ASSY_LEGPL Argininosuccinate synthase OS=Legionella pneumophila (strain Lens) GN=argG PE=3 SV=1 1 405 3.0E-74
sp|B1MZP4|ASSY_LEUCK Argininosuccinate synthase OS=Leuconostoc citreum (strain KM20) GN=argG PE=3 SV=1 7 405 4.0E-74
sp|Q8Y5H2|ASSY_LISMO Argininosuccinate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argG PE=3 SV=1 4 401 2.0E-73
sp|Q03W70|ASSY_LEUMM Argininosuccinate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=argG PE=3 SV=1 8 405 3.0E-73
sp|Q0RFB2|ASSY_FRAAA Argininosuccinate synthase OS=Frankia alni (strain ACN14a) GN=argG PE=3 SV=1 7 407 4.0E-73
sp|Q2J866|ASSY_FRASC Argininosuccinate synthase OS=Frankia sp. (strain CcI3) GN=argG PE=3 SV=1 7 407 5.0E-73
sp|Q032X6|ASSY_LACLS Argininosuccinate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argG PE=3 SV=1 7 409 7.0E-73
sp|Q04FC0|ASSY_OENOB Argininosuccinate synthase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=argG PE=3 SV=1 7 405 1.0E-72
sp|A4T9W4|ASSY_MYCGI Argininosuccinate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=argG PE=3 SV=1 7 398 1.0E-72
sp|Q1B7R1|ASSY_MYCSS Argininosuccinate synthase OS=Mycobacterium sp. (strain MCS) GN=argG PE=3 SV=1 7 398 2.0E-72
sp|A1UH96|ASSY_MYCSK Argininosuccinate synthase OS=Mycobacterium sp. (strain KMS) GN=argG PE=3 SV=1 7 398 2.0E-72
sp|B1W3B3|ASSY_STRGG Argininosuccinate synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=argG PE=3 SV=1 7 401 2.0E-72
sp|A3Q0T3|ASSY_MYCSJ Argininosuccinate synthase OS=Mycobacterium sp. (strain JLS) GN=argG PE=3 SV=1 7 398 2.0E-72
sp|C1ASZ6|ASSY_RHOOB Argininosuccinate synthase OS=Rhodococcus opacus (strain B4) GN=argG PE=3 SV=1 7 401 4.0E-72
sp|Q0SI58|ASSY_RHOJR Argininosuccinate synthase OS=Rhodococcus jostii (strain RHA1) GN=argG PE=3 SV=1 7 401 4.0E-72
sp|B3DSY7|ASSY_BIFLD Argininosuccinate synthase OS=Bifidobacterium longum (strain DJO10A) GN=argG PE=3 SV=1 1 411 6.0E-72
sp|A8LE46|ASSY_FRASN Argininosuccinate synthase OS=Frankia sp. (strain EAN1pec) GN=argG PE=3 SV=1 7 407 6.0E-72
sp|Q8G5F2|ASSY_BIFLO Argininosuccinate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=argG PE=3 SV=1 1 411 8.0E-72
sp|B7GTP0|ASSY_BIFLS Argininosuccinate synthase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=argG PE=3 SV=1 1 411 1.0E-71
sp|Q8FTM9|ASSY_COREF Argininosuccinate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argG PE=3 SV=1 7 412 2.0E-71
sp|A0QYS6|ASSY_MYCS2 Argininosuccinate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argG PE=3 SV=1 7 398 3.0E-71
sp|P57799|ASSY_LACLA Argininosuccinate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argG PE=3 SV=1 1 409 3.0E-71
sp|Q47N84|ASSY_THEFY Argininosuccinate synthase OS=Thermobifida fusca (strain YX) GN=argG PE=3 SV=1 7 401 4.0E-71
sp|Q12XK3|ASSY_METBU Argininosuccinate synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=argG PE=3 SV=1 7 410 4.0E-71
sp|Q2FLD8|ASSY_METHJ Argininosuccinate synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=argG PE=3 SV=1 5 380 7.0E-71
sp|Q827Z1|ASSY_STRAW Argininosuccinate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argG PE=3 SV=1 7 401 9.0E-71
sp|A1A1W7|ASSY_BIFAA Argininosuccinate synthase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=argG PE=3 SV=1 5 411 1.0E-70
sp|A1TAA6|ASSY_MYCVP Argininosuccinate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=argG PE=3 SV=1 7 398 1.0E-70
sp|A0LUB9|ASSY_ACIC1 Argininosuccinate synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=argG PE=3 SV=1 7 411 2.0E-70
sp|Q9CC10|ASSY_MYCLE Argininosuccinate synthase OS=Mycobacterium leprae (strain TN) GN=argG PE=3 SV=1 7 409 2.0E-70
sp|Q4JVZ8|ASSY_CORJK Argininosuccinate synthase OS=Corynebacterium jeikeium (strain K411) GN=argG PE=3 SV=1 5 401 2.0E-70
sp|P50986|ASSY_STRC2 Argininosuccinate synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argG PE=3 SV=1 7 401 5.0E-70
sp|O28032|ASSY_ARCFU Argininosuccinate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argG PE=3 SV=1 7 399 6.0E-70
sp|B2HR32|ASSY_MYCMM Argininosuccinate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=argG PE=3 SV=1 7 409 7.0E-70
sp|A5CSJ0|ASSY_CLAM3 Argininosuccinate synthase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=argG PE=3 SV=1 7 398 8.0E-70
sp|B0RHD5|ASSY_CLAMS Argininosuccinate synthase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=argG PE=3 SV=1 7 398 1.0E-69
sp|B1VH30|ASSY_CORU7 Argininosuccinate synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=argG PE=3 SV=1 5 401 1.0E-69
sp|Q5YYD3|ASSY_NOCFA Argininosuccinate synthase OS=Nocardia farcinica (strain IFM 10152) GN=argG PE=3 SV=1 7 401 2.0E-69
sp|A0PP79|ASSY_MYCUA Argininosuccinate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=argG PE=3 SV=1 7 409 3.0E-69
sp|P9WPW7|ASSY_MYCTU Argininosuccinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argG PE=1 SV=1 7 409 7.0E-69
sp|P9WPW6|ASSY_MYCTO Argininosuccinate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argG PE=3 SV=1 7 409 7.0E-69
sp|A5U315|ASSY_MYCTA Argininosuccinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=argG PE=3 SV=1 7 409 7.0E-69
sp|C1ANT1|ASSY_MYCBT Argininosuccinate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=argG PE=3 SV=1 7 409 7.0E-69
sp|A1KJ75|ASSY_MYCBP Argininosuccinate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=argG PE=3 SV=1 7 409 7.0E-69
sp|P63643|ASSY_MYCBO Argininosuccinate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argG PE=3 SV=1 7 409 7.0E-69
sp|Q469Z8|ASSY_METBF Argininosuccinate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argG PE=3 SV=1 7 403 1.0E-68
sp|Q93JQ8|ASSY_RHOFA Argininosuccinate synthase OS=Rhodococcus fascians GN=argG PE=3 SV=1 8 402 2.0E-68
sp|A0QHA8|ASSY_MYCA1 Argininosuccinate synthase OS=Mycobacterium avium (strain 104) GN=argG PE=3 SV=1 7 401 2.0E-67
sp|A0JV26|ASSY_ARTS2 Argininosuccinate synthase OS=Arthrobacter sp. (strain FB24) GN=argG PE=3 SV=1 7 409 3.0E-67
sp|Q8Q0U5|ASSY_METMA Argininosuccinate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argG PE=3 SV=1 7 403 3.0E-67
sp|P61525|ASSY_MYCPA Argininosuccinate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=argG PE=3 SV=1 7 401 3.0E-67
sp|P61521|ASSY_CORDI Argininosuccinate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argG PE=3 SV=1 7 401 4.0E-67
sp|A8LYQ9|ASSY_SALAI Argininosuccinate synthase OS=Salinispora arenicola (strain CNS-205) GN=argG PE=3 SV=1 7 395 5.0E-67
sp|P61527|ASSY_METMP Argininosuccinate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=argG PE=3 SV=1 9 382 8.0E-67
sp|C4LIE1|ASSY_CORK4 Argininosuccinate synthase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=argG PE=3 SV=1 7 401 2.0E-66
sp|B8HGC9|ASSY_ARTCA Argininosuccinate synthase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=argG PE=3 SV=1 7 401 2.0E-66
sp|A1R591|ASSY_ARTAT Argininosuccinate synthase OS=Arthrobacter aurescens (strain TC1) GN=argG PE=3 SV=1 7 401 6.0E-66
sp|Q8TNY5|ASSY_METAC Argininosuccinate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argG PE=3 SV=1 7 403 7.0E-66
sp|A4QDZ4|ASSY_CORGB Argininosuccinate synthase OS=Corynebacterium glutamicum (strain R) GN=argG PE=3 SV=1 7 401 1.0E-65
sp|O85176|ASSY_CORGL Argininosuccinate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argG PE=3 SV=2 7 401 1.0E-65
sp|A2BJL6|ASSY_HYPBU Argininosuccinate synthase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=argG PE=3 SV=1 7 398 3.0E-65
sp|B2GKD7|ASSY_KOCRD Argininosuccinate synthase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=argG PE=3 SV=1 7 395 6.0E-65
sp|C5CAM5|ASSY_MICLC Argininosuccinate synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=argG PE=3 SV=1 5 407 2.0E-64
sp|P13256|ASSY_METVA Argininosuccinate synthase OS=Methanococcus vannielii GN=argG PE=3 SV=1 10 382 4.0E-64
sp|A9WQ90|ASSY_RENSM Argininosuccinate synthase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=argG PE=3 SV=1 7 401 4.0E-64
sp|P13257|ASSY_METBA Argininosuccinate synthase OS=Methanosarcina barkeri GN=argG PE=3 SV=1 7 403 2.0E-63
sp|Q8TWU0|ASSY_METKA Argininosuccinate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argG PE=3 SV=1 7 374 4.0E-62
sp|O27322|ASSY_METTH Argininosuccinate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argG PE=3 SV=1 7 379 1.0E-60
sp|Q970V0|ASSY_SULTO Argininosuccinate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argG PE=3 SV=1 7 395 1.0E-60
sp|Q9UX31|ASSY_SULSO Argininosuccinate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argG PE=3 SV=2 7 399 4.0E-60
sp|Q18E36|ASSY_HALWD Argininosuccinate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=argG PE=3 SV=1 7 363 1.0E-59
sp|Q2NEC4|ASSY_METST Argininosuccinate synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argG PE=3 SV=1 7 407 8.0E-59
sp|A4YI75|ASSY_METS5 Argininosuccinate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=argG PE=3 SV=1 7 404 1.0E-57
sp|Q9HKF1|ASSY_THEAC Argininosuccinate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=argG PE=3 SV=2 7 395 8.0E-57
sp|Q60174|ASSY_METJA Argininosuccinate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argG PE=3 SV=1 9 407 2.0E-56
sp|Q3IME2|ASSY_NATPD Argininosuccinate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=argG PE=3 SV=1 5 393 7.0E-56
sp|Q6L1N7|ASSY_PICTO Argininosuccinate synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=argG PE=3 SV=1 7 395 1.0E-55
sp|Q5UZ46|ASSY_HALMA Argininosuccinate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=argG PE=3 SV=1 1 403 5.0E-55
sp|Q4J8F1|ASSY_SULAC Argininosuccinate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argG PE=3 SV=1 7 395 9.0E-54
sp|Q97A55|ASSY_THEVO Argininosuccinate synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=argG PE=3 SV=3 7 395 2.0E-53
sp|Q9HMQ2|ASSY_HALSA Argininosuccinate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=argG PE=3 SV=1 5 403 5.0E-52
sp|B0UW58|ASSY_HISS2 Argininosuccinate synthase OS=Histophilus somni (strain 2336) GN=argG PE=3 SV=1 7 398 1.0E-48
sp|Q0I4M1|ASSY_HAES1 Argininosuccinate synthase OS=Haemophilus somnus (strain 129Pt) GN=argG PE=3 SV=1 7 398 2.0E-48
sp|Q8XWC1|ASSY_RALSO Argininosuccinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=argG PE=3 SV=1 7 400 1.0E-47
sp|Q65SH4|ASSY_MANSM Argininosuccinate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argG PE=3 SV=1 7 398 1.0E-47
sp|B2UBA3|ASSY_RALPJ Argininosuccinate synthase OS=Ralstonia pickettii (strain 12J) GN=argG PE=3 SV=1 7 400 3.0E-47
sp|P57877|ASSY_PASMU Argininosuccinate synthase OS=Pasteurella multocida (strain Pm70) GN=argG PE=3 SV=1 7 398 7.0E-47
sp|A6VN06|ASSY_ACTSZ Argininosuccinate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=argG PE=3 SV=1 7 398 8.0E-47
sp|B4RQS8|ASSY_NEIG2 Argininosuccinate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=argG PE=3 SV=1 7 398 3.0E-46
sp|Q5F5G5|ASSY_NEIG1 Argininosuccinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argG PE=3 SV=1 7 398 3.0E-46
sp|A1KWJ8|ASSY_NEIMF Argininosuccinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argG PE=3 SV=1 7 398 3.0E-46
sp|Q9JWM1|ASSY_NEIMA Argininosuccinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argG PE=3 SV=1 7 398 6.0E-46
sp|B3Q9D3|ASSY_RHOPT Argininosuccinate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=argG PE=3 SV=1 8 398 1.0E-45
sp|Q6NCS7|ASSY_RHOPA Argininosuccinate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=argG PE=3 SV=1 8 398 1.0E-45
sp|Q9JXC1|ASSY_NEIMB Argininosuccinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argG PE=3 SV=1 7 398 2.0E-45
sp|A9M4B1|ASSY_NEIM0 Argininosuccinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=argG PE=3 SV=1 7 398 3.0E-45
sp|A1TNA2|ASSY_ACIAC Argininosuccinate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|B1JPT9|ASSY_YERPY Argininosuccinate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|Q66C31|ASSY_YERPS Argininosuccinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|A4TKI3|ASSY_YERPP Argininosuccinate synthase OS=Yersinia pestis (strain Pestoides F) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|Q1CGZ2|ASSY_YERPN Argininosuccinate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|A9R622|ASSY_YERPG Argininosuccinate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argG PE=3 SV=1 7 398 5.0E-45
sp|Q8ZFV7|ASSY_YERPE Argininosuccinate synthase OS=Yersinia pestis GN=argG PE=3 SV=3 7 398 5.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0004055 argininosuccinate synthase activity Yes
GO:0005524 ATP binding Yes
GO:0006526 arginine biosynthetic process Yes
GO:0019752 carboxylic acid metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0046394 carboxylic acid biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:0009064 glutamine family amino acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008150 biological_process No
GO:0016053 organic acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0000166 nucleotide binding No
GO:1901605 alpha-amino acid metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006525 arginine metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7050
MAGSKGRVCLAYSGGLDTSTILVWLLQQDYAVVCYLGNVGQEEDFAAVESKALKLGAEAFVCEDLQKELVDEVVA
KAIMCNASFEERYLLGTALARPIIARSQVRVAERYKCQYLSHGCTGKGNDQVRFELAFTALNPSLQVIAPWRMPE
FIKRFQGRNDLLKFAKDNNIPVSSSPKAPWSMDDNIVHCSYEAGVLEDPDHSPPKELWTRTVDPVDAPEKPQEFT
VHFEKGVITKVITAGKEVTDSVESFKLLNKIGHDHGVGRVDIVENRFIGLKSRGCYDTPGLTLARLAHLDLEGLV
MDSRVRELRDQFVSLTWSRQLYNGMYFSPEREFIENSIVFSQRNVSGVVRLAAYRGNAYVLGRSSSSSNLYSEQD
ASMDSLEGFSPEDTSGFIAIQAIRLKKYGQQKIKDGEPLSKS*
Coding >Ophun1|7050
ATGGCAGGTTCCAAGGGCCGCGTCTGTCTAGCCTACTCGGGCGGCCTCGACACCTCGACCATCCTCGTCTGGCTC
CTCCAGCAGGACTATGCCGTCGTCTGCTATCTCGGAAACGTGGGACAGGAGGAGGACTTTGCCGCCGTCGAGTCC
AAGGCCCTCAAGCTGGGCGCCGAAGCCTTTGTCTGCGAGGACCTGCAGAAGGAATTGGTCGACGAGGTGGTGGCC
AAGGCCATCATGTGCAATGCCTCGTTTGAGGAGAGGTATCTGCTCGGCACGGCTTTGGCTCGACCCATCATTGCC
AGGAGCCAGGTCCGCGTTGCTGAACGGTACAAGTGCCAGTATCTCAGCCATGGATGCACCGGCAAGGGCAATGAC
CAGGTCCGCTTCGAGCTCGCCTTTACCGCGCTGAACCCGTCTCTGCAAGTCATTGCTCCCTGGCGCATGCCCGAG
TTCATCAAGCGTTTCCAGGGCCGCAACGATCTTTTGAAGTTTGCCAAGGACAACAACATTCCCGTCTCGTCGAGT
CCCAAGGCCCCGTGGAGCATGGACGACAACATCGTTCACTGTTCTTATGAAGCGGGCGTCTTGGAGGATCCCGAT
CACAGCCCGCCCAAGGAGCTGTGGACTCGCACCGTCGATCCGGTCGATGCTCCGGAAAAGCCTCAGGAGTTTACG
GTTCACTTCGAGAAGGGCGTCATCACCAAGGTCATCACAGCCGGCAAGGAGGTGACTGACTCGGTCGAGTCGTTC
AAGCTTCTCAACAAGATCGGGCACGACCATGGCGTCGGCCGTGTCGACATTGTGGAAAACCGCTTCATCGGGCTC
AAGAGCCGAGGTTGCTACGACACTCCGGGATTGACGCTGGCCCGCCTCGCCCACTTGGACTTGGAAGGTCTGGTC
ATGGACTCGCGCGTGCGAGAGCTCCGTGACCAGTTCGTCTCTCTCACCTGGTCCCGACAGCTGTACAACGGCATG
TACTTTAGCCCGGAGCGCGAGTTCATCGAGAACTCGATCGTCTTTTCGCAGCGAAACGTCTCTGGCGTGGTCCGG
CTCGCTGCCTACCGGGGAAACGCCTACGTCCTGGGCCGCTCGAGCAGCTCGTCGAACCTGTACTCGGAGCAGGAC
GCGTCTATGGATTCTCTCGAGGGCTTCTCGCCCGAGGACACGAGTGGCTTCATCGCTATCCAGGCCATCCGTCTC
AAAAAGTACGGCCAGCAGAAGATTAAGGATGGAGAGCCGCTCAGCAAGTCGTAG
Transcript >Ophun1|7050
ATGGCAGGTTCCAAGGGCCGCGTCTGTCTAGCCTACTCGGGCGGCCTCGACACCTCGACCATCCTCGTCTGGCTC
CTCCAGCAGGACTATGCCGTCGTCTGCTATCTCGGAAACGTGGGACAGGAGGAGGACTTTGCCGCCGTCGAGTCC
AAGGCCCTCAAGCTGGGCGCCGAAGCCTTTGTCTGCGAGGACCTGCAGAAGGAATTGGTCGACGAGGTGGTGGCC
AAGGCCATCATGTGCAATGCCTCGTTTGAGGAGAGGTATCTGCTCGGCACGGCTTTGGCTCGACCCATCATTGCC
AGGAGCCAGGTCCGCGTTGCTGAACGGTACAAGTGCCAGTATCTCAGCCATGGATGCACCGGCAAGGGCAATGAC
CAGGTCCGCTTCGAGCTCGCCTTTACCGCGCTGAACCCGTCTCTGCAAGTCATTGCTCCCTGGCGCATGCCCGAG
TTCATCAAGCGTTTCCAGGGCCGCAACGATCTTTTGAAGTTTGCCAAGGACAACAACATTCCCGTCTCGTCGAGT
CCCAAGGCCCCGTGGAGCATGGACGACAACATCGTTCACTGTTCTTATGAAGCGGGCGTCTTGGAGGATCCCGAT
CACAGCCCGCCCAAGGAGCTGTGGACTCGCACCGTCGATCCGGTCGATGCTCCGGAAAAGCCTCAGGAGTTTACG
GTTCACTTCGAGAAGGGCGTCATCACCAAGGTCATCACAGCCGGCAAGGAGGTGACTGACTCGGTCGAGTCGTTC
AAGCTTCTCAACAAGATCGGGCACGACCATGGCGTCGGCCGTGTCGACATTGTGGAAAACCGCTTCATCGGGCTC
AAGAGCCGAGGTTGCTACGACACTCCGGGATTGACGCTGGCCCGCCTCGCCCACTTGGACTTGGAAGGTCTGGTC
ATGGACTCGCGCGTGCGAGAGCTCCGTGACCAGTTCGTCTCTCTCACCTGGTCCCGACAGCTGTACAACGGCATG
TACTTTAGCCCGGAGCGCGAGTTCATCGAGAACTCGATCGTCTTTTCGCAGCGAAACGTCTCTGGCGTGGTCCGG
CTCGCTGCCTACCGGGGAAACGCCTACGTCCTGGGCCGCTCGAGCAGCTCGTCGAACCTGTACTCGGAGCAGGAC
GCGTCTATGGATTCTCTCGAGGGCTTCTCGCCCGAGGACACGAGTGGCTTCATCGCTATCCAGGCCATCCGTCTC
AAAAAGTACGGCCAGCAGAAGATTAAGGATGGAGAGCCGCTCAGCAAGTCGTAG
Gene >Ophun1|7050
ATGGCAGGTTCCAAGGGCCGCGTCTGTCTAGCCTACTCGGGCGGCCTCGACACCTCGACCATCCTCGTCTGGCTC
CTCCAGCAGGACTATGCCGTCGTCTGCTATCTCGGAAACGTGGGACAGGAGGAGGACTTTGCCGCCGTCGAGTCC
AAGGCCCTCAAGCTGGGCGCCGAAGCCTTTGTCTGCGAGGACCTGCAGAAGGAATTGGTCGACGAGGTGGTGGCC
AAGGCCATCATGTGCAATGCCTCGTTTGAGGAGAGGTATCTGCTCGGCACGGCTTTGGCTCGACCCATCATTGCC
AGGAGCCAGGTCCGCGTTGCTGAACGGTACAAGTGCCAGTATCTCAGCCATGGATGCACCGGCAAGGGCAATGAC
CAGGTCCGCTTCGAGCTCGCCTTTACCGCGCTGAACCCGTCTCTGCAAGTCATTGCTCCCTGGCGCATGCCCGAG
TTCATCAAGCGTTTCCAGGGCCGCAACGATCTTTTGAAGTTTGCCAAGGACAACAACATTCCCGTCTCGTCGAGT
CCCAAGGCCCCGTGGAGCATGGACGACAACATCGTTCACTGTTCTTATGAAGCGGGCGTCTTGGAGGATCCCGAT
CACAGCCCGCCCAAGGAGCTGTGGACTCGCACCGTCGATCCGGTCGATGCTCCGGAAAAGCCTCAGGAGTTTACG
GTTCACTTCGAGAAGGGCGTCATCACCAAGGTCATCACAGCCGGCAAGGAGGTGACTGACTCGGTCGAGTCGTTC
AAGCTTCTCAACAAGATCGGGCACGACCATGGCGTCGGCCGTGTCGACATTGTGGAAAACCGCTTCATCGGGCTC
AAGAGCCGAGGTTGCTACGACACTCCGGGATTGACGCTGGCCCGCCTCGCCCACTTGGACTTGGAAGGTCTGGTC
ATGGACTCGCGCGTGCGAGAGCTCCGTGACCAGTTCGTCTCTCTCACCTGGTCCCGACAGCTGTACAACGGCATG
TACTTTAGCCCGGAGCGCGAGTTCATCGAGAACTCGATCGTCTTTTCGCAGCGAAACGTCTCTGGCGTGGTCCGG
CTCGCTGCCTACCGGGGAAACGCCTACGTCCTGGGCCGCTCGAGCAGCTCGTCGAACCTGTACTCGGAGCAGGAC
GCGTCTATGGATTCTCTCGAGGGCTTCTCGCCCGAGGACACGAGTGGCTTCATCGCTATCCAGGCCATCCGTCTC
AAAAAGTACGGCCAGCAGAAGATTAAGGATGGAGAGCCGCTCAGCAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail