© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|7043 |
| Gene name | |
| Location | Contig_831:2163..2588 |
| Strand | + |
| Gene length (bp) | 425 |
| Transcript length (bp) | 270 |
| Coding sequence length (bp) | 270 |
| Protein length (aa) | 90 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF07297 | DPM2 | Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) | 4.2E-31 | 3 | 76 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q556K9|DPM2_DICDI | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Dictyostelium discoideum GN=dpm2-1 PE=3 SV=1 | 3 | 77 | 7.0E-16 |
| sp|Q9USW6|DPM2_SCHPO | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm2 PE=3 SV=1 | 14 | 78 | 3.0E-14 |
| sp|Q2KIN1|DPM2_BOVIN | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Bos taurus GN=DPM2 PE=3 SV=3 | 3 | 82 | 3.0E-13 |
| sp|O94777|DPM2_HUMAN | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens GN=DPM2 PE=1 SV=3 | 3 | 79 | 3.0E-12 |
| sp|Q9Z1P1|DPM2_CRIGR | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Cricetulus griseus GN=DPM2 PE=3 SV=3 | 3 | 79 | 2.0E-11 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q556K9|DPM2_DICDI | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Dictyostelium discoideum GN=dpm2-1 PE=3 SV=1 | 3 | 77 | 7.0E-16 |
| sp|Q9USW6|DPM2_SCHPO | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm2 PE=3 SV=1 | 14 | 78 | 3.0E-14 |
| sp|Q2KIN1|DPM2_BOVIN | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Bos taurus GN=DPM2 PE=3 SV=3 | 3 | 82 | 3.0E-13 |
| sp|O94777|DPM2_HUMAN | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens GN=DPM2 PE=1 SV=3 | 3 | 79 | 3.0E-12 |
| sp|Q9Z1P1|DPM2_CRIGR | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Cricetulus griseus GN=DPM2 PE=3 SV=3 | 3 | 79 | 2.0E-11 |
| sp|Q9Z324|DPM2_MOUSE | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Mus musculus GN=Dpm2 PE=3 SV=3 | 3 | 79 | 8.0E-09 |
| sp|Q9Z325|DPM2_RAT | Dolichol phosphate-mannose biosynthesis regulatory protein OS=Rattus norvegicus GN=Dpm2 PE=1 SV=3 | 3 | 47 | 1.0E-08 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0019348 | dolichol metabolic process | Yes |
| GO:0030176 | integral component of endoplasmic reticulum membrane | Yes |
| GO:0030234 | enzyme regulator activity | Yes |
| GO:0016093 | polyprenol metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0031224 | intrinsic component of membrane | No |
| GO:0006629 | lipid metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0008152 | metabolic process | No |
| GO:0098772 | molecular function regulator activity | No |
| GO:0031301 | integral component of organelle membrane | No |
| GO:0044255 | cellular lipid metabolic process | No |
| GO:0006720 | isoprenoid metabolic process | No |
| GO:0006066 | alcohol metabolic process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0005575 | cellular_component | No |
| GO:0003674 | molecular_function | No |
| GO:0031227 | intrinsic component of endoplasmic reticulum membrane | No |
| GO:0016021 | integral component of membrane | No |
| GO:0008150 | biological_process | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0031300 | intrinsic component of organelle membrane | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:1901615 | organic hydroxy compound metabolic process | No |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 5 | 27 | 22 |
| 2 | 47 | 69 | 22 |
| Orthofinder run ID | 4 |
| Orthogroup | 6417 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|7043 MLDKLLGLAMLVAASVVFLYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVIFVLLVSAVVGSFLGTVMIRSNR KKASKAKAAAKKKA* |
| Coding | >Ophun1|7043 ATGCTCGACAAACTCTTAGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC CTCCTCATGCCCTTCGTGGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATCCGAATC CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA |
| Transcript | >Ophun1|7043 ATGCTCGACAAACTCTTAGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC CTCCTCATGCCCTTCGTGGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATCCGAATC CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA |
| Gene | >Ophun1|7043 ATGGTACCTATTCCCCCGATCCCACCCATATCAATGCTAACGCCTCCCAGCTCGACAAACTCTTAGGCCTCGCCA TGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACCCTCCTCATGGTCCGTACACTCCTCAATC CCACCCTCCGCCTTTCCCTCTCGCGAATCTCCCTCTCCCTCTCGCAAAAAACTCCCATCCACCCCCTACCACCTC ACTAACCAGCCCAGCCCTTCGTGGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATCC GAATCCCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCA ACCGCAAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA |