Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7042
Gene name
LocationContig_831:121..1817
Strand-
Gene length (bp)1696
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02847 MA3 MA3 domain 6.7E-24 377 482
PF02854 MIF4G MIF4G domain 1.5E-11 91 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BGP1|CWC22_EMENI Pre-mRNA-splicing factor cwc22 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc22 PE=3 SV=2 32 524 0.0E+00
sp|Q52B63|CWC22_MAGO7 Pre-mRNA-splicing factor CWC22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC22 PE=3 SV=1 5 524 0.0E+00
sp|Q7RX84|CWC22_NEUCR Pre-mRNA-splicing factor cwc22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-1 PE=3 SV=1 11 524 0.0E+00
sp|P0CM96|CWC22_CRYNJ Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC22 PE=3 SV=1 36 524 0.0E+00
sp|P0CM97|CWC22_CRYNB Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC22 PE=3 SV=1 36 524 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BGP1|CWC22_EMENI Pre-mRNA-splicing factor cwc22 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc22 PE=3 SV=2 32 524 0.0E+00
sp|Q52B63|CWC22_MAGO7 Pre-mRNA-splicing factor CWC22 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CWC22 PE=3 SV=1 5 524 0.0E+00
sp|Q7RX84|CWC22_NEUCR Pre-mRNA-splicing factor cwc22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-1 PE=3 SV=1 11 524 0.0E+00
sp|P0CM96|CWC22_CRYNJ Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC22 PE=3 SV=1 36 524 0.0E+00
sp|P0CM97|CWC22_CRYNB Pre-mRNA-splicing factor CWC22 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC22 PE=3 SV=1 36 524 0.0E+00
sp|Q9P6R9|CWC22_SCHPO Pre-mRNA-splicing factor cwf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf22 PE=1 SV=3 45 524 0.0E+00
sp|Q4PCY0|CWC22_USTMA Pre-mRNA-splicing factor CWC22 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC22 PE=3 SV=2 40 524 0.0E+00
sp|Q4WKB9|CWC22_ASPFU Pre-mRNA-splicing factor cwc22 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc22 PE=3 SV=1 29 524 0.0E+00
sp|Q52KN9|CWC22_XENLA Pre-mRNA-splicing factor CWC22 homolog OS=Xenopus laevis GN=cwc22 PE=2 SV=1 36 524 4.0E-173
sp|Q9VJ87|CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster GN=ncm PE=1 SV=3 31 524 1.0E-171
sp|Q5RA93|CWC22_PONAB Pre-mRNA-splicing factor CWC22 homolog OS=Pongo abelii GN=CWC22 PE=2 SV=1 13 524 4.0E-169
sp|Q5ZKA3|CWC22_CHICK Pre-mRNA-splicing factor CWC22 homolog OS=Gallus gallus GN=CWC22 PE=2 SV=2 26 524 3.0E-168
sp|Q9HCG8|CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens GN=CWC22 PE=1 SV=3 13 524 3.0E-168
sp|Q08C72|CWC22_DANRE Pre-mRNA-splicing factor CWC22 homolog OS=Danio rerio GN=cwc22 PE=2 SV=1 24 524 4.0E-168
sp|Q8C5N3|CWC22_MOUSE Pre-mRNA-splicing factor CWC22 homolog OS=Mus musculus GN=Cwc22 PE=1 SV=1 20 524 7.0E-168
sp|Q17336|CWC22_CAEEL Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis elegans GN=let-858 PE=2 SV=1 28 524 1.0E-161
sp|A8WT19|CWC22_CAEBR Pre-mRNA-splicing factor CWC22 homolog OS=Caenorhabditis briggsae GN=let-858 PE=3 SV=2 23 524 7.0E-156
sp|Q6C8C5|CWC22_YARLI Pre-mRNA-splicing factor CWC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC22 PE=3 SV=1 38 524 6.0E-147
sp|Q6BU84|CWC22_DEBHA Pre-mRNA-splicing factor CWC22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC22 PE=3 SV=2 47 524 2.0E-142
sp|Q59XY0|CWC22_CANAL Pre-mRNA-splicing factor CWC22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC22 PE=3 SV=1 81 524 1.0E-90
sp|Q751P4|CWC22_ASHGO Pre-mRNA-splicing factor CWC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CWC22 PE=3 SV=1 79 524 4.0E-55
sp|P53333|CWC22_YEAST Pre-mRNA-splicing factor CWC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC22 PE=1 SV=1 71 524 7.0E-44
sp|Q3UFM5|NOM1_MOUSE Nucleolar MIF4G domain-containing protein 1 OS=Mus musculus GN=Nom1 PE=1 SV=2 47 494 3.0E-20
sp|Q5C9Z4|NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens GN=NOM1 PE=1 SV=1 56 494 3.0E-19
sp|O13971|SGD1_SCHPO Suppressor of glycerol defect protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgd1 PE=3 SV=1 51 471 3.0E-13
sp|Q06132|SGD1_YEAST Suppressor of glycerol defect protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGD1 PE=1 SV=1 59 509 3.0E-07
sp|Q9W020|NOM1_DROME Nucleolar MIF4G domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG9004 PE=2 SV=1 33 509 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0005515 protein binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3845
Ophiocordyceps australis map64 (Brazil) OphauB2|5687
Ophiocordyceps camponoti-floridani Ophcf2|04472
Ophiocordyceps camponoti-rufipedis Ophun1|7042 (this protein)
Ophiocordyceps kimflemingae Ophio5|2319
Ophiocordyceps subramaniannii Hirsu2|1052

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7042
MASARAEMPRRDRGGDSYRPSRPRRPRSRSPAPKPTEEEKQAAAKQEYQRLLNVRSGGTYMPPARLRALQAQITD
KTSKEYQRMAWEALKKSINGLINKVNTANIKHIVPELFGENLVRGRGLFCRSVMKAQAASLPFTAVYAAMVAVVN
TKLPQVGELLVQRLVVQFRKAFRRNDKGVCLSATSFLAHLVNQQVLHEMLAGQILLLLLHKPTDDSVEIAVGFCR
EVGQYIEEMQPAMAVAVFDQFRNILHEAGIDKRTQYMVEVLFQVRKDKFRDNPAVREELDLVEEEDQITHQVSLE
GDIDVQDGLNVFKFDDEWEENEEAYRKLRGEILGESGEESEEDGDEDDDGEESAEEEDEETKALEIKDQSNADLV
NLRRTIYLTIMSSADPEEAVHKLMKINLPAGQEAELPSMIIECCSQEKTYTKFFGLIGERFAKINRLWCDLFEQA
FTKYYDTIHRYENNKLRNMAMLFGHMLAQDAIGWHCLSAIQLTEEETTSSSRIFIKILLQSVAEELGLSKLKARG
*
Coding >Ophun1|7042
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGATCGTGGCGGCGACTCTTACCGCCCGTCGAGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCTGCAGCCAAGCAAGAATACCAACGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGTCTGCGGGCGCTCCAGGCACAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACGGCAAACATCAAGCACATCGTTCCCGAGCTGTTTGGCGAGAACCTGGTGAGGGGCAGGGGGTTGTTTTGC
CGGTCTGTTATGAAGGCTCAGGCGGCGAGCTTGCCGTTTACGGCGGTGTATGCGGCCATGGTTGCGGTGGTGAAT
ACCAAGTTGCCGCAGGTGGGCGAGCTGCTCGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGCGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTTGCCCATCTTGTTAACCAGCAGGTTCTTCACGAGATGTTG
GCTGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTGGGGTTCTGTCGG
GAGGTTGGTCAGTACATTGAGGAGATGCAGCCTGCCATGGCCGTGGCCGTCTTCGACCAGTTCAGGAATATCCTG
CACGAGGCTGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTTTTCCAGGTCCGCAAGGATAAGTTTCGC
GACAACCCTGCCGTCAGGGAGGAGCTGGACCTTGTGGAGGAAGAGGATCAGATCACGCATCAGGTCAGCCTCGAG
GGCGACATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGACGACGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGGGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAGGATGGTGATGAGGACGACGACGGC
GAGGAGAGTGCGGAGGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAGTCCAACGCGGATCTCGTC
AACCTCCGACGAACAATCTACCTAACCATCATGTCCAGCGCCGACCCGGAGGAAGCAGTGCACAAACTCATGAAG
ATCAACCTCCCCGCCGGCCAAGAAGCAGAGCTCCCCTCGATGATCATCGAATGCTGCTCGCAGGAAAAGACGTAC
ACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAACCGACTGTGGTGCGACCTCTTCGAACAAGCC
TTTACGAAATACTACGACACCATCCACCGCTACGAGAACAACAAGCTGCGCAACATGGCCATGCTCTTCGGCCAC
ATGCTCGCCCAGGACGCCATCGGCTGGCACTGCCTGTCGGCGATCCAGCTGACGGAGGAGGAGACGACGTCGAGC
AGCCGCATCTTCATCAAGATTCTGCTGCAGAGCGTTGCGGAGGAGCTGGGCCTTTCGAAGCTCAAGGCCAGGGGT
TGA
Transcript >Ophun1|7042
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGATCGTGGCGGCGACTCTTACCGCCCGTCGAGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCTGCAGCCAAGCAAGAATACCAACGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGTCTGCGGGCGCTCCAGGCACAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACGGCAAACATCAAGCACATCGTTCCCGAGCTGTTTGGCGAGAACCTGGTGAGGGGCAGGGGGTTGTTTTGC
CGGTCTGTTATGAAGGCTCAGGCGGCGAGCTTGCCGTTTACGGCGGTGTATGCGGCCATGGTTGCGGTGGTGAAT
ACCAAGTTGCCGCAGGTGGGCGAGCTGCTCGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGCGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTTGCCCATCTTGTTAACCAGCAGGTTCTTCACGAGATGTTG
GCTGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTGGGGTTCTGTCGG
GAGGTTGGTCAGTACATTGAGGAGATGCAGCCTGCCATGGCCGTGGCCGTCTTCGACCAGTTCAGGAATATCCTG
CACGAGGCTGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTTTTCCAGGTCCGCAAGGATAAGTTTCGC
GACAACCCTGCCGTCAGGGAGGAGCTGGACCTTGTGGAGGAAGAGGATCAGATCACGCATCAGGTCAGCCTCGAG
GGCGACATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGACGACGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGGGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAGGATGGTGATGAGGACGACGACGGC
GAGGAGAGTGCGGAGGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAGTCCAACGCGGATCTCGTC
AACCTCCGACGAACAATCTACCTAACCATCATGTCCAGCGCCGACCCGGAGGAAGCAGTGCACAAACTCATGAAG
ATCAACCTCCCCGCCGGCCAAGAAGCAGAGCTCCCCTCGATGATCATCGAATGCTGCTCGCAGGAAAAGACGTAC
ACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAACCGACTGTGGTGCGACCTCTTCGAACAAGCC
TTTACGAAATACTACGACACCATCCACCGCTACGAGAACAACAAGCTGCGCAACATGGCCATGCTCTTCGGCCAC
ATGCTCGCCCAGGACGCCATCGGCTGGCACTGCCTGTCGGCGATCCAGCTGACGGAGGAGGAGACGACGTCGAGC
AGCCGCATCTTCATCAAGATTCTGCTGCAGAGCGTTGCGGAGGAGCTGGGCCTTTCGAAGCTCAAGGCCAGGGGT
TGA
Gene >Ophun1|7042
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGATCGTGGCGGCGACTCTTACCGCCCGTCGAGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCTGCAGCCAAGCAAGAATACCAACGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGTCTGCGGGCGCTCCAGGCACAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACGGCAAACATCAAGCACATCGTTCCCGAGCTGTTTGGCGAGAACCTGGTGAGGGGCAGGGGGTTGTTTTGC
CGGTCTGTTATGAAGGCTCAGGCGGCGAGCTTGCCGTTTACGGCGGTGTATGCGGCCATGGTTGCGGTGGTGAAT
ACCAAGTTGCCGCAGGTGGGCGAGCTGCTCGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGCGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTTGCCCATCTTGTTAACCAGCAGGTTCTTCACGAGATGTTG
GCTGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTGGGGTTCTGTCGG
GAGGTTGGTCAGTACATTGAGGAGATGCAGCCTGCCATGGCCGTGGCCGTCTTCGACCAGTTCAGGAATATCCTG
CACGAGGCTGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTTTTCCAGGTCCGCAAGGATAAGTTTCGC
GACAACCCTGCCGTCAGGGAGGAGCTGGACCTTGTGGAGGAAGAGGATCAGATCACGCATCAGGTCAGCCTCGAG
GGCGACATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGACGACGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGGGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAGGATGGTGATGAGGACGACGACGGC
GAGGAGAGTGCGGAGGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAGTCCAACGCGGATCTCGTC
AACCTCCGACGAACAATCTACCTAACCATCATGTCCAGCGCCGACCCGGAGGAAGCAGTGCACAAACTCATGAAG
ATCAACCTCCCCGCCGGCCAAGAAGCAGAGCTCCCCTCGATGATCATCGAATGCTGCTCGCAGGAAAAGACGTAC
ACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAACCGACTGTGGTGCGACCTCTTCGAACAAGCC
TTTACGAAATACTACGACACCATCCACCGCTACGAGAACAACAAGCTGCGCAACATGGCCATGCTCTTCGGCCAC
ATGCTCGCCCAGGACGCCATCGGCTGGCACTGCCTGTCGGCGATCCAGCTGACGGAGGAGGAGACGACGTCGAGC
AGCCGCATCTTCATCAAGATTCTGCTGCAGAGCGTTGCGGAGGAGCTGGGCCTTTCGAAGCTCAAGGCCAGGTGC
GAGGATGAGGTGGGCAGGGGGGGGTTGACGGGGTTGTTTCCCGAGGAGGGGGTTCGGAACTTGCGGTTTGCTATC
AATTATTTCACGAGTATTGGGTTGGGGGTCTTGACGGAGGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail