Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|704
Gene name
LocationContig_1226:883..2870
Strand+
Gene length (bp)1987
Transcript length (bp)1857
Coding sequence length (bp)1857
Protein length (aa) 619

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09804 DENND11 DENN domain-containing protein 11 9.1E-95 31 322
PF14831 DUF4484 Domain of unknown function (DUF4484) 1.4E-62 389 618

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FZX0|LCHN_XENLA Protein LCHN OS=Xenopus laevis GN=lchn PE=2 SV=1 28 317 6.0E-27
sp|P36090|ANR2_YEAST Uncharacterized protein ANR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANR2 PE=1 SV=1 14 409 3.0E-26
sp|Q1LX49|LCHN_DANRE Protein LCHN OS=Danio rerio GN=lchn PE=3 SV=1 28 317 1.0E-24
sp|Q3UHG7|LCHN_MOUSE Protein LCHN OS=Mus musculus GN=Lchn PE=2 SV=1 30 354 2.0E-22
sp|Q0PGW2|LCHN_RAT Protein LCHN OS=Rattus norvegicus GN=Lchn PE=2 SV=1 30 354 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FZX0|LCHN_XENLA Protein LCHN OS=Xenopus laevis GN=lchn PE=2 SV=1 28 317 6.0E-27
sp|P36090|ANR2_YEAST Uncharacterized protein ANR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANR2 PE=1 SV=1 14 409 3.0E-26
sp|Q1LX49|LCHN_DANRE Protein LCHN OS=Danio rerio GN=lchn PE=3 SV=1 28 317 1.0E-24
sp|Q3UHG7|LCHN_MOUSE Protein LCHN OS=Mus musculus GN=Lchn PE=2 SV=1 30 354 2.0E-22
sp|Q0PGW2|LCHN_RAT Protein LCHN OS=Rattus norvegicus GN=Lchn PE=2 SV=1 30 354 3.0E-22
sp|A4D1U4|LCHN_HUMAN Protein LCHN OS=Homo sapiens GN=LCHN PE=2 SV=1 30 354 3.0E-22
sp|O42907|YBAG_SCHPO Uncharacterized protein C119.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC119.16c PE=4 SV=1 28 355 9.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|704
MAPRDGRRRRRHDSVSLPVSAPADRPPLSALFLVDFDVKAGYTISWRRAVSGLDLDGRVEYKSLPSGLHTVSSDL
VYFVHDGAHAGLSAFVNVPCREAAARHARMMAVGVLVPLSYGRLGRAWRHAASLEHMASKLAKDPAAVEVLDRYW
QTNRAQQTDAAALDDLPPSPSLERRTLGRGRSASDGTALQPNRLSPYHPAWSLTGLLDRLGPLIFPIYRAALLRR
RILISCHAPVRDMCHLVYDISILSNIPVSVADSLPASSPTPRLTPLFTVGVHDIPFLAEQGKQGEGQPTAGWIAC
TTDSILAVKDTLWDMLITMPAQRDAWPSVECPRGRMVKATQRDLRRYNALRAGLARLAVRPDSHRSETTASETQR
QRMTRDDEPLDQVVEPPSWASLAYSGYMWWASAGEQLRSEAQEESGRDAALLADLDSWAPSPSSTTSLPTAAGLG
DSVGSLAGGGRRRRRRSAGGELDEAEADEARVELAIIAYFHRLTAQMLSVLVDLVDASNVAVEAHNRYRDRVEHH
QHDGSGGGYRGRQQREDEDETRALLDEGDDDDGSSDGMPADDVTVSSRCVDSMGLDVWSGADAVFIQELMAVYFG
REARIEGKGVEVCGVRVC*
Coding >Ophun1|704
ATGGCTCCTCGCGACGGCCGCCGTCGACGCCGCCACGACTCCGTCTCGCTGCCCGTCTCGGCGCCGGCGGACCGG
CCCCCGCTGTCGGCGCTGTTCCTCGTCGACTTTGACGTCAAGGCTGGGTATACGATTTCGTGGCGGCGGGCGGTG
TCCGGGCTGGATCTCGACGGGCGAGTCGAGTACAAGTCTCTGCCTTCGGGGTTGCACACCGTCTCGAGCGACCTC
GTCTACTTTGTCCATGATGGTGCGCACGCGGGGCTGAGTGCCTTTGTCAACGTGCCTTGTCGGGAGGCGGCGGCG
AGGCATGCGCGCATGATGGCTGTCGGGGTTCTGGTGCCCTTGAGTTATGGGAGGTTGGGGAGGGCTTGGAGGCAT
GCTGCCAGCTTGGAGCATATGGCTTCGAAGCTGGCCAAGGATCCTGCGGCTGTTGAAGTGCTGGATCGTTATTGG
CAGACGAACAGAGCGCAGCAGACGGATGCAGCGGCTCTTGACGATTTGCCTCCGTCGCCGTCGCTCGAGCGGAGG
ACTCTTGGTCGCGGACGGTCTGCTTCCGATGGAACGGCCTTGCAGCCGAATCGACTCTCGCCATATCACCCGGCT
TGGAGCCTGACTGGGCTGCTGGATAGGCTTGGGCCGCTCATCTTTCCCATCTATCGCGCCGCCTTGCTGCGGAGA
CGCATCTTGATATCGTGTCATGCTCCGGTCCGAGACATGTGCCATTTGGTCTACGACATCTCCATCCTGTCCAAC
ATTCCCGTCTCCGTCGCCGATTCTCTGCCGGCATCGTCGCCCACGCCGCGTCTGACGCCCCTTTTCACCGTCGGT
GTTCACGATATCCCCTTTCTCGCAGAGCAGGGAAAGCAAGGCGAGGGGCAACCGACCGCGGGCTGGATCGCCTGC
ACGACGGACAGCATCCTCGCCGTCAAGGACACGCTATGGGACATGCTCATCACCATGCCAGCCCAGCGCGACGCC
TGGCCGTCTGTCGAGTGTCCTCGCGGAAGGATGGTCAAGGCCACGCAGCGCGACCTGCGGCGGTATAACGCGCTC
CGGGCCGGACTTGCTAGATTGGCGGTGCGGCCGGATTCGCACCGGTCCGAGACGACGGCTTCGGAGACGCAGCGA
CAGCGGATGACGCGCGATGATGAGCCGCTCGATCAGGTGGTGGAACCCCCGAGCTGGGCCTCGCTCGCCTACAGT
GGTTACATGTGGTGGGCCAGCGCGGGCGAGCAGCTGCGGTCCGAGGCGCAGGAGGAGTCGGGCCGCGACGCTGCG
TTGCTGGCGGACCTGGACTCTTGGGCGCCGTCTCCGTCGTCGACGACGTCGCTCCCTACTGCTGCTGGTCTGGGA
GACTCGGTCGGGTCGCTCGCAGGGGGTGGGCGTCGTCGGCGTCGTCGGTCTGCGGGCGGGGAGCTGGACGAGGCA
GAGGCGGACGAGGCGAGGGTCGAGTTGGCCATCATTGCTTACTTTCATCGTCTCACGGCCCAGATGCTGTCTGTG
CTGGTGGATCTGGTGGACGCGAGCAATGTCGCGGTCGAGGCGCATAACCGGTACCGCGACCGTGTTGAGCATCAC
CAGCACGATGGCAGCGGAGGGGGATACAGGGGGAGGCAGCAGCGCGAGGACGAGGACGAGACGCGGGCTCTTCTC
GACGAGGGAGACGATGACGACGGGTCCTCGGATGGGATGCCCGCTGACGACGTCACCGTCTCGAGCCGGTGCGTC
GACTCGATGGGGCTCGACGTGTGGAGCGGCGCGGATGCAGTCTTTATTCAGGAGCTGATGGCTGTGTATTTCGGG
CGTGAGGCGCGGATTGAGGGAAAGGGGGTTGAGGTCTGTGGCGTGAGGGTGTGCTAG
Transcript >Ophun1|704
ATGGCTCCTCGCGACGGCCGCCGTCGACGCCGCCACGACTCCGTCTCGCTGCCCGTCTCGGCGCCGGCGGACCGG
CCCCCGCTGTCGGCGCTGTTCCTCGTCGACTTTGACGTCAAGGCTGGGTATACGATTTCGTGGCGGCGGGCGGTG
TCCGGGCTGGATCTCGACGGGCGAGTCGAGTACAAGTCTCTGCCTTCGGGGTTGCACACCGTCTCGAGCGACCTC
GTCTACTTTGTCCATGATGGTGCGCACGCGGGGCTGAGTGCCTTTGTCAACGTGCCTTGTCGGGAGGCGGCGGCG
AGGCATGCGCGCATGATGGCTGTCGGGGTTCTGGTGCCCTTGAGTTATGGGAGGTTGGGGAGGGCTTGGAGGCAT
GCTGCCAGCTTGGAGCATATGGCTTCGAAGCTGGCCAAGGATCCTGCGGCTGTTGAAGTGCTGGATCGTTATTGG
CAGACGAACAGAGCGCAGCAGACGGATGCAGCGGCTCTTGACGATTTGCCTCCGTCGCCGTCGCTCGAGCGGAGG
ACTCTTGGTCGCGGACGGTCTGCTTCCGATGGAACGGCCTTGCAGCCGAATCGACTCTCGCCATATCACCCGGCT
TGGAGCCTGACTGGGCTGCTGGATAGGCTTGGGCCGCTCATCTTTCCCATCTATCGCGCCGCCTTGCTGCGGAGA
CGCATCTTGATATCGTGTCATGCTCCGGTCCGAGACATGTGCCATTTGGTCTACGACATCTCCATCCTGTCCAAC
ATTCCCGTCTCCGTCGCCGATTCTCTGCCGGCATCGTCGCCCACGCCGCGTCTGACGCCCCTTTTCACCGTCGGT
GTTCACGATATCCCCTTTCTCGCAGAGCAGGGAAAGCAAGGCGAGGGGCAACCGACCGCGGGCTGGATCGCCTGC
ACGACGGACAGCATCCTCGCCGTCAAGGACACGCTATGGGACATGCTCATCACCATGCCAGCCCAGCGCGACGCC
TGGCCGTCTGTCGAGTGTCCTCGCGGAAGGATGGTCAAGGCCACGCAGCGCGACCTGCGGCGGTATAACGCGCTC
CGGGCCGGACTTGCTAGATTGGCGGTGCGGCCGGATTCGCACCGGTCCGAGACGACGGCTTCGGAGACGCAGCGA
CAGCGGATGACGCGCGATGATGAGCCGCTCGATCAGGTGGTGGAACCCCCGAGCTGGGCCTCGCTCGCCTACAGT
GGTTACATGTGGTGGGCCAGCGCGGGCGAGCAGCTGCGGTCCGAGGCGCAGGAGGAGTCGGGCCGCGACGCTGCG
TTGCTGGCGGACCTGGACTCTTGGGCGCCGTCTCCGTCGTCGACGACGTCGCTCCCTACTGCTGCTGGTCTGGGA
GACTCGGTCGGGTCGCTCGCAGGGGGTGGGCGTCGTCGGCGTCGTCGGTCTGCGGGCGGGGAGCTGGACGAGGCA
GAGGCGGACGAGGCGAGGGTCGAGTTGGCCATCATTGCTTACTTTCATCGTCTCACGGCCCAGATGCTGTCTGTG
CTGGTGGATCTGGTGGACGCGAGCAATGTCGCGGTCGAGGCGCATAACCGGTACCGCGACCGTGTTGAGCATCAC
CAGCACGATGGCAGCGGAGGGGGATACAGGGGGAGGCAGCAGCGCGAGGACGAGGACGAGACGCGGGCTCTTCTC
GACGAGGGAGACGATGACGACGGGTCCTCGGATGGGATGCCCGCTGACGACGTCACCGTCTCGAGCCGGTGCGTC
GACTCGATGGGGCTCGACGTGTGGAGCGGCGCGGATGCAGTCTTTATTCAGGAGCTGATGGCTGTGTATTTCGGG
CGTGAGGCGCGGATTGAGGGAAAGGGGGTTGAGGTCTGTGGCGTGAGGGTGTGCTAG
Gene >Ophun1|704
ATGGCTCCTCGCGACGGCCGCCGTCGACGCCGCCACGACTCCGTCTCGCTGCCCGTCTCGGCGCCGGCGGACCGG
CCCCCGCTGTCGGCGCTGTTCCTCGTCGACTTTGACGTCAAGGCTGGGTATACGATTTCGTGGCGGCGGGCGGTG
TCCGGGCTGGATCTCGACGGGCGAGTCGAGTACAAGTCTCTGCCTTCGGGGTTGCACACCGTCTCGAGCGACCTC
GTCTACTTTGTCCATGATGGTGCGCACGCGGGGCTGAGTGCCTTTGTCAACGTGCCTTGTCGGGAGGCGGCGGCG
AGGCATGCGCGCATGATGGCTGTCGGGGTTCTGGTGCCCTTGAGTTATGGGAGGTTGGGGAGGGCTTGGAGGCAT
GCTGCCAGCTTGGAGCATATGGCTTCGTGAGTTTTTCTTTTTTTTTCTTTGTTGGTGGGTTTTTGTCGTCTTGAT
TGCTGATGGATGGGTTTGACTCGGGTAGGAAGCTGGCCAAGGATCCTGCGGCTGTTGAAGTGCTGGATCGTTATT
GGCAGACGAACAGAGCGCAGCAGACGGATGCAGCGGCTCTTGACGATTTGCCTCCGTCGCCGTCGCTCGAGCGGA
GGACTCTTGGTCGCGGACGGTCTGCTTCCGATGGAACGGCCTTGCAGCCGAATCGACTCTCGCCATATCACCCGG
CTTGGAGCCTGACTGGGCTGCTGGATAGGCTTGGGCCGCTCATCTTTCCCATCTATCGCGCCGCCTTGCTGCGGA
GACGCATCTTGATATCGTGTCATGCTCCGGTCCGAGACATGTGCCATTTGGGTGGGTTTTCTGTGTGGTGTGCTT
CGAGGCTGGGTCGGCTGATGAGGTGACAGTCTACGACATCTCCATCCTGTCCAACATTCCCGTCTCCGTCGCCGA
TTCTCTGCCGGCATCGTCGCCCACGCCGCGTCTGACGCCCCTTTTCACCGTCGGTGTTCACGATATCCCCTTTCT
CGCAGAGCAGGGAAAGCAAGGCGAGGGGCAACCGACCGCGGGCTGGATCGCCTGCACGACGGACAGCATCCTCGC
CGTCAAGGACACGCTATGGGACATGCTCATCACCATGCCAGCCCAGCGCGACGCCTGGCCGTCTGTCGAGTGTCC
TCGCGGAAGGATGGTCAAGGCCACGCAGCGCGACCTGCGGCGGTATAACGCGCTCCGGGCCGGACTTGCTAGATT
GGCGGTGCGGCCGGATTCGCACCGGTCCGAGACGACGGCTTCGGAGACGCAGCGACAGCGGATGACGCGCGATGA
TGAGCCGCTCGATCAGGTGGTGGAACCCCCGAGCTGGGCCTCGCTCGCCTACAGTGGTTACATGTGGTGGGCCAG
CGCGGGCGAGCAGCTGCGGTCCGAGGCGCAGGAGGAGTCGGGCCGCGACGCTGCGTTGCTGGCGGACCTGGACTC
TTGGGCGCCGTCTCCGTCGTCGACGACGTCGCTCCCTACTGCTGCTGGTCTGGGAGACTCGGTCGGGTCGCTCGC
AGGGGGTGGGCGTCGTCGGCGTCGTCGGTCTGCGGGCGGGGAGCTGGACGAGGCAGAGGCGGACGAGGCGAGGGT
CGAGTTGGCCATCATTGCTTACTTTCATCGTCTCACGGCCCAGATGCTGTCTGTGCTGGTGGATCTGGTGGACGC
GAGCAATGTCGCGGTCGAGGCGCATAACCGGTACCGCGACCGTGTTGAGCATCACCAGCACGATGGCAGCGGAGG
GGGATACAGGGGGAGGCAGCAGCGCGAGGACGAGGACGAGACGCGGGCTCTTCTCGACGAGGGAGACGATGACGA
CGGGTCCTCGGATGGGATGCCCGCTGACGACGTCACCGTCTCGAGCCGGTGCGTCGACTCGATGGGGCTCGACGT
GTGGAGCGGCGCGGATGCAGTCTTTATTCAGGAGCTGATGGCTGTGTATTTCGGGCGTGAGGCGCGGATTGAGGG
AAAGGGGGTTGAGGTCTGTGGCGTGAGGGTGTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail