Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7037
Gene name
LocationContig_83:34694..36388
Strand-
Gene length (bp)1694
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2002
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5331
Ophiocordyceps australis map64 (Brazil) OphauB2|7634
Ophiocordyceps camponoti-floridani Ophcf2|00434
Ophiocordyceps camponoti-rufipedis Ophun1|7037 (this protein)
Ophiocordyceps kimflemingae Ophio5|678
Ophiocordyceps subramaniannii Hirsu2|2242

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7037
MTPWNGAVSRPRPRSETKSIRGIISGPMPLSSLSGPVDDMSDDAYFVPWRASRHLDVERARKTTTTTTTTTTTGT
GTSTGHGRSTIIKSALGKLLSRRKKPADRPTPIDTSPQHHRSDPLSETRPSNIFASKRAASLPVTEYDRALRSHS
ISPEDVLAIRSVGSSLHADSASRAEASDAINKLAHLAGSPPRPASSHGRRLRVADWTEDPDDIGRAITSDMRRRS
RSVSAFPISVSAFVRPARRRSRDIFSWPTPPSSAVQDTTTTLTADEQEVDAGVVYRPRSRDEAAYAQLAKLNSRV
TDLEARNAKLEQVVAKLADSLARLTSPLPRDEHPEAIVAMTQGPKLAADSEKTAPQTNSCGSRPLSLATVRNDSG
KTMTADQYLSLVNLLETERSAREVLEGQIRSLSHQVYMTTSEVARRPSAVVSHGGVSAFDLDDDDDDDDDEEEEE
DGVVEPIRSFSRCAASSQGRGWNDYDDEDEEADEDEEEETRERKAYRGSLDLEASAEEDVVEETVLKATARAMSL
SRLTLSMTPFPVQRLPSGAVA*
Coding >Ophun1|7037
ATGACGCCGTGGAACGGTGCCGTCTCCCGTCCGAGGCCCCGCTCCGAGACCAAGTCTATCCGGGGCATCATCTCG
GGGCCCATGCCTCTGTCGTCTCTGTCGGGCCCCGTTGACGACATGTCTGACGACGCTTATTTCGTTCCTTGGCGT
GCCAGTCGTCACTTGGACGTTGAACGGGCTCGCAAGACGACAACCACGACGACAACGACGACGACGACGGGCACG
GGCACGAGCACGGGTCATGGCAGGTCGACCATCATCAAGTCGGCCTTGGGCAAGCTGCTCAGTCGCAGGAAGAAG
CCCGCGGACAGGCCAACCCCCATTGATACATCGCCTCAGCACCATCGCAGTGACCCATTGAGTGAGACCAGGCCC
TCCAACATATTCGCATCGAAACGGGCTGCCTCGCTTCCCGTCACCGAATATGACCGCGCCTTGCGGTCCCATTCC
ATCAGTCCCGAGGACGTCTTGGCTATCCGCAGCGTCGGCAGCTCCCTCCACGCTGATTCGGCCTCCAGGGCAGAG
GCATCGGACGCTATCAATAAGCTGGCTCACCTCGCCGGCTCGCCTCCGCGCCCTGCGAGCTCTCATGGCCGCCGT
CTCAGAGTGGCCGACTGGACCGAGGATCCCGATGATATCGGCCGAGCCATCACCAGCGACATGAGACGGCGTTCC
CGGAGCGTGTCTGCCTTTCCCATCTCCGTCAGCGCCTTCGTGCGTCCGGCGAGGAGGCGGAGTCGGGACATCTTT
TCCTGGCCGACGCCGCCCTCGTCTGCTGTCCAAGACACGACGACGACTCTTACGGCCGACGAGCAAGAGGTTGAT
GCTGGCGTTGTGTATCGACCACGGTCCCGAGACGAAGCAGCATATGCCCAGCTGGCCAAGCTGAACTCGCGCGTC
ACCGACCTCGAGGCACGGAATGCGAAGCTGGAGCAAGTCGTCGCCAAACTGGCCGACTCGTTGGCGAGGCTCACA
TCTCCTTTGCCGCGGGACGAACATCCAGAGGCAATCGTGGCCATGACCCAAGGCCCTAAGCTGGCCGCTGATTCG
GAAAAGACGGCGCCTCAGACGAACTCATGCGGCAGTCGACCTCTGTCGCTGGCGACGGTGCGCAACGACTCCGGA
AAGACGATGACGGCGGATCAGTACCTCTCCCTCGTCAACCTCCTGGAGACGGAGCGTTCGGCTCGCGAGGTTCTC
GAGGGACAGATTAGGAGCCTGAGTCACCAAGTGTACATGACGACGTCCGAGGTGGCGAGACGGCCGTCGGCAGTG
GTCTCGCATGGAGGCGTGTCGGCTTTTGACCTCGACGACGATGATGATGATGATGATGATGAGGAGGAGGAGGAG
GATGGCGTCGTGGAGCCGATAAGGTCCTTTTCCCGCTGTGCGGCTTCTTCTCAGGGCCGAGGCTGGAACGACTAT
GATGACGAGGACGAGGAGGCGGACGAGGATGAGGAGGAAGAAACTCGTGAGCGCAAGGCGTACCGCGGCTCGTTG
GACTTGGAAGCGTCGGCGGAGGAGGACGTCGTCGAGGAGACGGTCTTGAAGGCGACGGCCAGGGCCATGTCCCTC
TCGCGCTTGACGCTGAGCATGACTCCTTTTCCGGTTCAGCGGCTGCCTTCTGGAGCCGTGGCTTGA
Transcript >Ophun1|7037
ATGACGCCGTGGAACGGTGCCGTCTCCCGTCCGAGGCCCCGCTCCGAGACCAAGTCTATCCGGGGCATCATCTCG
GGGCCCATGCCTCTGTCGTCTCTGTCGGGCCCCGTTGACGACATGTCTGACGACGCTTATTTCGTTCCTTGGCGT
GCCAGTCGTCACTTGGACGTTGAACGGGCTCGCAAGACGACAACCACGACGACAACGACGACGACGACGGGCACG
GGCACGAGCACGGGTCATGGCAGGTCGACCATCATCAAGTCGGCCTTGGGCAAGCTGCTCAGTCGCAGGAAGAAG
CCCGCGGACAGGCCAACCCCCATTGATACATCGCCTCAGCACCATCGCAGTGACCCATTGAGTGAGACCAGGCCC
TCCAACATATTCGCATCGAAACGGGCTGCCTCGCTTCCCGTCACCGAATATGACCGCGCCTTGCGGTCCCATTCC
ATCAGTCCCGAGGACGTCTTGGCTATCCGCAGCGTCGGCAGCTCCCTCCACGCTGATTCGGCCTCCAGGGCAGAG
GCATCGGACGCTATCAATAAGCTGGCTCACCTCGCCGGCTCGCCTCCGCGCCCTGCGAGCTCTCATGGCCGCCGT
CTCAGAGTGGCCGACTGGACCGAGGATCCCGATGATATCGGCCGAGCCATCACCAGCGACATGAGACGGCGTTCC
CGGAGCGTGTCTGCCTTTCCCATCTCCGTCAGCGCCTTCGTGCGTCCGGCGAGGAGGCGGAGTCGGGACATCTTT
TCCTGGCCGACGCCGCCCTCGTCTGCTGTCCAAGACACGACGACGACTCTTACGGCCGACGAGCAAGAGGTTGAT
GCTGGCGTTGTGTATCGACCACGGTCCCGAGACGAAGCAGCATATGCCCAGCTGGCCAAGCTGAACTCGCGCGTC
ACCGACCTCGAGGCACGGAATGCGAAGCTGGAGCAAGTCGTCGCCAAACTGGCCGACTCGTTGGCGAGGCTCACA
TCTCCTTTGCCGCGGGACGAACATCCAGAGGCAATCGTGGCCATGACCCAAGGCCCTAAGCTGGCCGCTGATTCG
GAAAAGACGGCGCCTCAGACGAACTCATGCGGCAGTCGACCTCTGTCGCTGGCGACGGTGCGCAACGACTCCGGA
AAGACGATGACGGCGGATCAGTACCTCTCCCTCGTCAACCTCCTGGAGACGGAGCGTTCGGCTCGCGAGGTTCTC
GAGGGACAGATTAGGAGCCTGAGTCACCAAGTGTACATGACGACGTCCGAGGTGGCGAGACGGCCGTCGGCAGTG
GTCTCGCATGGAGGCGTGTCGGCTTTTGACCTCGACGACGATGATGATGATGATGATGATGAGGAGGAGGAGGAG
GATGGCGTCGTGGAGCCGATAAGGTCCTTTTCCCGCTGTGCGGCTTCTTCTCAGGGCCGAGGCTGGAACGACTAT
GATGACGAGGACGAGGAGGCGGACGAGGATGAGGAGGAAGAAACTCGTGAGCGCAAGGCGTACCGCGGCTCGTTG
GACTTGGAAGCGTCGGCGGAGGAGGACGTCGTCGAGGAGACGGTCTTGAAGGCGACGGCCAGGGCCATGTCCCTC
TCGCGCTTGACGCTGAGCATGACTCCTTTTCCGGTTCAGCGGCTGCCTTCTGGAGCCGTGGCTTGA
Gene >Ophun1|7037
ATGACGCCGTGGAACGGTGCCGTCTCCCGTCCGAGGCCCCGCTCCGAGACCAAGTCTATCCGGGGCATCATCTCG
GGGCCCATGCCTCTGTCGTCTCTGTCGGGCCCCGTTGACGACATGTCTGACGACGCTTATTTCGTTCCTTGGCGT
GCCAGTCGTCACTTGGACGTTGAACGGGCTCGCAAGACGACAACCACGACGACAACGACGACGACGACGGGCACG
GGCACGAGCACGGGTCATGGCAGGTCGACCATCATCAAGTCGGCCTTGGGCAAGCTGCTCAGTCGCAGGAAGAAG
CCCGCGGACAGGCCAACCCCCATTGATACATCGCCTCAGCACCATCGCAGTGTAAGATGTCCCGGCCCCTATCCC
ACTGTCCAGTCCCTCAACCGCCGACGCAGGACCCATTGAGTGAGACCAGGCCCTCCAACATATTCGCATCGAAAC
GGGCTGCCTCGCTTCCCGTCACCGAATATGACCGCGCCTTGCGGTCCCATTCCATCAGTCCCGAGGACGTCTTGG
CTATCCGCAGCGTCGGCAGCTCCCTCCACGCTGATTCGGCCTCCAGGGCAGAGGCATCGGACGCTATCAATAAGC
TGGCTCACCTCGCCGGCTCGCCTCCGCGCCCTGCGAGCTCTCATGGCCGCCGTCTCAGAGTGGCCGACTGGACCG
AGGATCCCGATGATATCGGCCGAGCCATCACCAGCGACATGAGACGGCGTTCCCGGAGCGTGTCTGCCTTTCCCA
TCTCCGTCAGCGCCTTCGTGCGTCCGGCGAGGAGGCGGAGTCGGGACATCTTTTCCTGGCCGACGCCGCCCTCGT
CTGCTGTCCAAGACACGACGACGACTCTTACGGCCGACGAGCAAGAGGTTGATGCTGGCGTTGTGTATCGACCAC
GGTCCCGAGACGAAGCAGCATATGCCCAGCTGGCCAAGCTGAACTCGCGCGTCACCGACCTCGAGGCACGGAATG
CGAAGCTGGAGCAAGTCGTCGCCAAACTGGCCGACTCGTTGGCGAGGCTCACATCTCCTTTGCCGCGGGACGAAC
ATCCAGAGGCAATCGTGGCCATGACCCAAGGCCCTAAGCTGGCCGCTGATTCGGAAAAGACGGCGCCTCAGACGA
ACTCATGCGGCAGTCGACCTCTGTCGCTGGCGACGGTGCGCAACGACTCCGGAAAGACGATGACGGCGGATCAGT
ACCTCTCCCTCGTCAACCTCCTGGAGACGGAGCGTTCGGCTCGCGAGGTTCTCGAGGGACAGATTAGGAGCCTGA
GTCACCAAGTGTACATGACGACGTCCGAGGTGGCGAGACGGCCGTCGGCAGTGGTCTCGCATGGAGGCGTGTCGG
CTTTTGACCTCGACGACGATGATGATGATGATGATGATGAGGAGGAGGAGGAGGATGGCGTCGTGGAGCCGATAA
GGTCCTTTTCCCGCTGTGCGGCTTCTTCTCAGGGCCGAGGCTGGAACGACTATGATGACGAGGACGAGGAGGCGG
ACGAGGATGAGGAGGAAGAAACTCGTGAGCGCAAGGCGTACCGCGGCTCGTTGGACTTGGAAGCGTCGGCGGAGG
AGGACGTCGTCGAGGAGACGGTCTTGAAGGCGACGGCCAGGGCCATGTCCCTCTCGCGCTTGACGCTGAGCATGA
CTCCTTTTCCGGTTCAGCGGCTGCCTTCTGGAGCCGTGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail