Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7034
Gene name
LocationContig_83:29354..30626
Strand+
Gene length (bp)1272
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 7.3E-44 86 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 15 342 1.0E-88
sp|P53720|DUS2_YEAST tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 15 376 1.0E-87
sp|Q9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS2 PE=1 SV=1 17 377 1.0E-58
sp|Q9D7B1|DUS2L_MOUSE tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus2 PE=1 SV=1 17 307 3.0E-58
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 26 268 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 15 342 1.0E-88
sp|P53720|DUS2_YEAST tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 15 376 1.0E-87
sp|Q9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS2 PE=1 SV=1 17 377 1.0E-58
sp|Q9D7B1|DUS2L_MOUSE tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus2 PE=1 SV=1 17 307 3.0E-58
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 26 268 2.0E-20
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 22 341 2.0E-20
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 22 311 8.0E-20
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 22 281 1.0E-19
sp|Q9HGN6|DUS1_SCHPO tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 14 328 2.0E-19
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 22 323 8.0E-19
sp|P41504|DUS_RHILP Probable tRNA-dihydrouridine synthase OS=Rhizobium leguminosarum bv. phaseoli GN=dus PE=3 SV=1 18 265 4.0E-15
sp|Q8PP72|DUSB_XANAC tRNA-dihydrouridine synthase B OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dusB PE=3 SV=1 20 268 7.0E-14
sp|P0A2R6|DUSB_SALTY tRNA-dihydrouridine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusB PE=3 SV=1 18 277 1.0E-13
sp|P0A2R7|DUSB_SALTI tRNA-dihydrouridine synthase B OS=Salmonella typhi GN=dusB PE=3 SV=1 18 277 1.0E-13
sp|Q8PCH1|DUSB_XANCP tRNA-dihydrouridine synthase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dusB PE=3 SV=1 20 268 1.0E-13
sp|Q8ZAX7|DUSB_YERPE tRNA-dihydrouridine synthase B OS=Yersinia pestis GN=dusB PE=3 SV=1 87 277 2.0E-13
sp|O52536|DUSB_KLEPN tRNA-dihydrouridine synthase B OS=Klebsiella pneumoniae GN=dusB PE=3 SV=1 18 306 2.0E-13
sp|P0ABT5|DUSB_ECOLI tRNA-dihydrouridine synthase B OS=Escherichia coli (strain K12) GN=dusB PE=3 SV=1 18 277 3.0E-13
sp|P0ABT6|DUSB_ECOL6 tRNA-dihydrouridine synthase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusB PE=3 SV=1 18 277 3.0E-13
sp|P0ABT7|DUSB_ECO57 tRNA-dihydrouridine synthase B OS=Escherichia coli O157:H7 GN=dusB PE=3 SV=1 18 277 3.0E-13
sp|O52533|DUSB_PROVU tRNA-dihydrouridine synthase B OS=Proteus vulgaris GN=dusB PE=3 SV=2 87 277 3.0E-13
sp|A5DBS1|DUS3_PICGU tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DUS3 PE=3 SV=2 12 268 3.0E-13
sp|A3LUK5|DUS3_PICST tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DUS3 PE=3 SV=1 12 268 4.0E-13
sp|P67716|DUS_STAAM Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dus PE=3 SV=1 81 271 9.0E-13
sp|P67717|DUS_STAAN Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain N315) GN=dus PE=1 SV=1 81 271 9.0E-13
sp|Q8NYV4|DUS_STAAW Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MW2) GN=dus PE=3 SV=1 81 271 1.0E-12
sp|Q6GD38|DUS_STAAS Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MSSA476) GN=dus PE=3 SV=1 81 271 1.0E-12
sp|Q5HJT5|DUS_STAAC Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain COL) GN=dus PE=3 SV=2 81 271 1.0E-12
sp|Q6GKK9|DUS_STAAR Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MRSA252) GN=dus PE=3 SV=1 81 271 1.0E-12
sp|P53759|DUS1_YEAST tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 22 322 1.0E-12
sp|P44965|DUSB_HAEIN tRNA-dihydrouridine synthase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusB PE=3 SV=1 18 269 2.0E-12
sp|Q83PZ5|DUSB_SHIFL tRNA-dihydrouridine synthase B OS=Shigella flexneri GN=dusB PE=3 SV=1 18 277 4.0E-12
sp|Q9CLW3|DUSB_PASMU tRNA-dihydrouridine synthase B OS=Pasteurella multocida (strain Pm70) GN=dusB PE=3 SV=2 18 269 4.0E-12
sp|A8PTG4|DUS3_MALGO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=DUS3 PE=3 SV=1 9 268 8.0E-12
sp|A8NZY7|DUS3_COPC7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=DUS3 PE=3 SV=1 12 268 1.0E-11
sp|O67533|DUS_AQUAE Probable tRNA-dihydrouridine synthase OS=Aquifex aeolicus (strain VF5) GN=dus PE=3 SV=1 18 331 1.0E-11
sp|Q9KT00|DUSC_VIBCH tRNA-dihydrouridine(16) synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusC PE=3 SV=1 82 282 2.0E-11
sp|O52539|DUSB_PECCA tRNA-dihydrouridine synthase B OS=Pectobacterium carotovorum GN=dusB PE=3 SV=2 87 269 2.0E-11
sp|Q54CU9|DUS3L_DICDI tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Dictyostelium discoideum GN=dus3l PE=3 SV=1 12 268 2.0E-11
sp|Q87N01|DUSC_VIBPA tRNA-dihydrouridine(16) synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusC PE=3 SV=1 82 331 4.0E-11
sp|Q7XT07|DUS3L_ORYSJ tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Oryza sativa subsp. japonica GN=Os04g0117600 PE=2 SV=2 12 237 5.0E-11
sp|Q7ZWS1|DUS3L_XENLA tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus laevis GN=dus3l PE=2 SV=1 9 268 6.0E-11
sp|Q8CU07|DUS_STAES Probable tRNA-dihydrouridine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dus PE=3 SV=1 81 271 8.0E-11
sp|Q8C2P3|DUS1L_MOUSE tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 22 268 8.0E-11
sp|O31546|DUS2_BACSU Probable tRNA-dihydrouridine synthase 2 OS=Bacillus subtilis (strain 168) GN=dus2 PE=3 SV=1 82 271 8.0E-11
sp|Q5HKD5|DUS_STAEQ Probable tRNA-dihydrouridine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dus PE=3 SV=1 81 271 8.0E-11
sp|Q8K582|DUS1L_RAT tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 22 268 1.0E-10
sp|Q28BT8|DUS3L_XENTR tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus tropicalis GN=dus3l PE=2 SV=2 9 268 1.0E-10
sp|Q8DAH1|DUSC_VIBVU tRNA-dihydrouridine(16) synthase OS=Vibrio vulnificus (strain CMCP6) GN=dusC PE=3 SV=2 71 338 1.0E-10
sp|Q8CWL2|DUSB_VIBVU tRNA-dihydrouridine synthase B OS=Vibrio vulnificus (strain CMCP6) GN=dusB PE=3 SV=2 18 269 1.0E-10
sp|Q9T0J6|DUS3L_ARATH tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Arabidopsis thaliana GN=At4g38890 PE=1 SV=2 12 237 2.0E-10
sp|Q7VNP2|DUSB_HAEDU tRNA-dihydrouridine synthase B OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusB PE=3 SV=1 20 282 3.0E-10
sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 22 268 5.0E-10
sp|A7TQ73|DUS3_VANPO tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DUS3 PE=3 SV=1 12 268 6.0E-10
sp|Q6BS64|DUS3_DEBHA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DUS3 PE=3 SV=1 12 268 1.0E-09
sp|Q55724|DUS1_SYNY3 Probable tRNA-dihydrouridine synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dus1 PE=3 SV=1 99 265 1.0E-09
sp|Q6FJ14|DUS3_CANGA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DUS3 PE=3 SV=1 12 222 2.0E-09
sp|Q0CZL3|DUS3_ASPTN tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dus3 PE=3 SV=1 22 193 2.0E-09
sp|O52532|DUSB_SERMA tRNA-dihydrouridine synthase B OS=Serratia marcescens GN=dusB PE=3 SV=2 87 277 2.0E-09
sp|Q6CWM0|DUS3_KLULA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DUS3 PE=3 SV=1 12 268 2.0E-09
sp|Q8ZGV2|DUSC_YERPE tRNA-dihydrouridine(16) synthase OS=Yersinia pestis GN=dusC PE=3 SV=2 85 282 3.0E-09
sp|Q1E2F4|DUS3_COCIM tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coccidioides immitis (strain RS) GN=DUS3 PE=3 SV=1 22 268 4.0E-09
sp|Q6C4K3|DUS3_YARLI tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DUS3 PE=3 SV=1 9 221 4.0E-09
sp|A5DTS1|DUS3_LODEL tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DUS3 PE=3 SV=1 12 268 1.0E-08
sp|Q7UC91|DUSC_SHIFL tRNA-dihydrouridine(16) synthase OS=Shigella flexneri GN=dusC PE=3 SV=1 83 282 1.0E-08
sp|Q91XI1|DUS3L_MOUSE tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus3l PE=1 SV=1 9 268 2.0E-08
sp|Q3KRC5|DUS3L_RAT tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus3l PE=2 SV=1 9 268 3.0E-08
sp|Q4P1U2|DUS3_USTMA tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DUS3 PE=3 SV=1 9 268 3.0E-08
sp|A7A1S5|DUS3_YEAS7 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain YJM789) GN=DUS3 PE=3 SV=1 12 268 3.0E-08
sp|Q06053|DUS3_YEAST tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS3 PE=1 SV=2 12 268 3.0E-08
sp|Q5ALL3|DUS3_CANAL tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUS3 PE=3 SV=1 12 268 3.0E-08
sp|Q9CJW1|DUSC_PASMU tRNA-dihydrouridine(16) synthase OS=Pasteurella multocida (strain Pm70) GN=dusC PE=3 SV=1 84 282 3.0E-08
sp|Q8XEC6|DUSC_ECO57 tRNA-dihydrouridine(16) synthase OS=Escherichia coli O157:H7 GN=dusC PE=3 SV=1 84 282 3.0E-08
sp|Q8FFV5|DUSC_ECOL6 tRNA-dihydrouridine(16) synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusC PE=3 SV=2 83 282 3.0E-08
sp|Q96G46|DUS3L_HUMAN tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 9 268 3.0E-08
sp|P33371|DUSC_ECOLI tRNA-dihydrouridine(16) synthase OS=Escherichia coli (strain K12) GN=dusC PE=1 SV=1 83 282 4.0E-08
sp|P44606|DUSC_HAEIN tRNA-dihydrouridine(16) synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusC PE=3 SV=1 82 281 5.0E-08
sp|P37567|DUS1_BACSU Probable tRNA-dihydrouridine synthase 1 OS=Bacillus subtilis (strain 168) GN=dus1 PE=3 SV=1 15 265 6.0E-08
sp|Q9ZLB6|DUS_HELPJ Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dus PE=3 SV=1 15 268 7.0E-08
sp|P45672|DUS_AZOBR Probable tRNA-dihydrouridine synthase OS=Azospirillum brasilense GN=dus PE=3 SV=1 15 265 7.0E-08
sp|Q8EJR8|DUSB_SHEON tRNA-dihydrouridine synthase B OS=Shewanella oneidensis (strain MR-1) GN=dusB PE=3 SV=1 87 269 1.0E-07
sp|O25427|DUS_HELPY Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dus PE=3 SV=1 15 268 1.0E-07
sp|O83945|DUS_TREPA Probable tRNA-dihydrouridine synthase OS=Treponema pallidum (strain Nichols) GN=dus PE=3 SV=1 100 276 2.0E-07
sp|Q9KV66|DUSB_VIBCH tRNA-dihydrouridine synthase B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusB PE=3 SV=2 87 269 2.0E-07
sp|Q9ZED2|DUS_RICPR Probable tRNA-dihydrouridine synthase OS=Rickettsia prowazekii (strain Madrid E) GN=dus PE=3 SV=2 15 265 3.0E-07
sp|P9WNS6|DUS_MYCTO Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dus PE=3 SV=1 99 268 3.0E-07
sp|P9WNS7|DUS_MYCTU Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dus PE=1 SV=1 99 268 3.0E-07
sp|A6QYC6|DUS3_AJECN tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DUS3 PE=3 SV=1 22 268 3.0E-07
sp|Q8ZNM4|DUSC_SALTY tRNA-dihydrouridine(16) synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusC PE=3 SV=1 109 282 3.0E-07
sp|Q8XYX1|DUSC_RALSO tRNA-dihydrouridine(16) synthase OS=Ralstonia solanacearum (strain GMI1000) GN=dusC PE=3 SV=1 97 265 3.0E-07
sp|Q4UNJ4|DUS_RICFE Probable tRNA-dihydrouridine synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dus PE=3 SV=1 15 265 5.0E-07
sp|Q9HUW1|DUSB_PSEAE tRNA-dihydrouridine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusB PE=3 SV=1 20 269 5.0E-07
sp|Q92JQ6|DUS_RICCN Probable tRNA-dihydrouridine synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dus PE=3 SV=2 15 265 6.0E-07
sp|Q88DK5|DUSB_PSEPK tRNA-dihydrouridine synthase B OS=Pseudomonas putida (strain KT2440) GN=dusB PE=3 SV=1 123 269 8.0E-07
sp|Q8Z5B2|DUSC_SALTI tRNA-dihydrouridine(16) synthase OS=Salmonella typhi GN=dusC PE=3 SV=1 109 282 1.0E-06
sp|Q68XZ3|DUS_RICTY Probable tRNA-dihydrouridine synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dus PE=3 SV=1 15 265 1.0E-06
sp|Q7SG01|DUS3_NEUCR tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dus-3 PE=3 SV=1 22 207 1.0E-06
sp|Q87VS1|DUSB_PSESM tRNA-dihydrouridine synthase B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dusB PE=3 SV=1 21 276 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7034
MLGQAVKVPIPRRGVDYRGKIVLAPMVRSGELPSRLLALSCGADLVWGPETVDLSMIGTTRRFNHESKTIEWSRP
TSHGPIDSIIYRMCPAREAGKLIFQIGTSDPERAVQAARLVAADVAGIDVNAGCPKPFSTSGGMGAALLKTPDKL
CAILEALVSNITPEYEIGISVKIRILETAAETEALIRRLCATGITGLTVHCRTTPMRPRHRAIRDQLRMVAQVCH
EYGVACLMNGDVENRDQGVALAAEYGADGAMIATAAEKNPSCFRPETEGLLPWRDVVCHYVKIAMGVHNRFANTK
FLLSHMIPGKEPLFQQAAKVKSYSQTCTILQLDHLAEQAADVDAAMGLDPAYVKASRRGKSNPSALAAGGHMERT
HPRKALSDRSVVEQALQEKQESVSLAAT*
Coding >Ophun1|7034
ATGCTTGGGCAAGCAGTCAAAGTCCCGATTCCCCGTCGGGGCGTCGATTACCGCGGCAAGATTGTTCTGGCGCCT
ATGGTTCGTTCAGGAGAACTGCCTTCCAGGTTGCTTGCTCTCAGCTGCGGCGCAGACCTCGTCTGGGGACCCGAG
ACGGTCGACCTGTCCATGATTGGCACCACCAGACGCTTCAACCATGAGTCCAAGACCATCGAATGGTCTCGTCCC
ACTTCCCATGGCCCGATCGACTCCATCATCTATAGAATGTGTCCAGCCAGGGAAGCAGGAAAGCTCATCTTTCAA
ATCGGAACGTCGGATCCCGAACGCGCCGTCCAGGCAGCCCGACTGGTGGCGGCAGACGTGGCGGGAATCGACGTC
AACGCCGGCTGCCCCAAGCCCTTTAGCACCAGCGGCGGCATGGGCGCGGCCCTCCTCAAAACGCCCGACAAGCTG
TGCGCCATTCTCGAGGCTCTCGTCAGCAACATCACGCCCGAGTATGAGATTGGCATCAGCGTCAAGATTCGCATC
TTGGAGACGGCCGCCGAGACCGAGGCCCTGATAAGACGGCTCTGCGCCACGGGAATCACGGGGCTCACCGTTCAT
TGCCGGACGACGCCGATGCGGCCGCGCCATCGAGCCATCCGGGACCAGCTGCGCATGGTTGCCCAAGTCTGTCAC
GAGTACGGCGTCGCGTGTCTAATGAATGGCGACGTGGAGAATAGGGACCAGGGCGTCGCGCTGGCTGCAGAGTAC
GGCGCAGACGGGGCCATGATCGCCACGGCGGCCGAGAAGAACCCGTCCTGCTTCAGACCCGAGACCGAAGGGCTA
CTTCCATGGCGAGACGTCGTGTGTCACTACGTAAAGATTGCCATGGGCGTCCACAATCGCTTCGCAAACACAAAG
TTCCTCCTGTCGCATATGATTCCCGGCAAGGAACCGCTCTTCCAGCAGGCTGCCAAAGTCAAGAGTTACAGCCAA
ACTTGCACCATCCTGCAGCTGGATCACCTCGCCGAGCAGGCAGCAGACGTCGACGCGGCCATGGGATTGGATCCG
GCCTACGTCAAGGCGTCGAGGCGAGGGAAATCGAACCCCAGCGCCTTGGCTGCCGGTGGCCACATGGAGCGAACT
CATCCTCGCAAGGCGCTGTCAGACCGTTCCGTCGTCGAGCAGGCGCTGCAAGAGAAGCAAGAGTCGGTTTCTTTG
GCAGCGACTTGA
Transcript >Ophun1|7034
ATGCTTGGGCAAGCAGTCAAAGTCCCGATTCCCCGTCGGGGCGTCGATTACCGCGGCAAGATTGTTCTGGCGCCT
ATGGTTCGTTCAGGAGAACTGCCTTCCAGGTTGCTTGCTCTCAGCTGCGGCGCAGACCTCGTCTGGGGACCCGAG
ACGGTCGACCTGTCCATGATTGGCACCACCAGACGCTTCAACCATGAGTCCAAGACCATCGAATGGTCTCGTCCC
ACTTCCCATGGCCCGATCGACTCCATCATCTATAGAATGTGTCCAGCCAGGGAAGCAGGAAAGCTCATCTTTCAA
ATCGGAACGTCGGATCCCGAACGCGCCGTCCAGGCAGCCCGACTGGTGGCGGCAGACGTGGCGGGAATCGACGTC
AACGCCGGCTGCCCCAAGCCCTTTAGCACCAGCGGCGGCATGGGCGCGGCCCTCCTCAAAACGCCCGACAAGCTG
TGCGCCATTCTCGAGGCTCTCGTCAGCAACATCACGCCCGAGTATGAGATTGGCATCAGCGTCAAGATTCGCATC
TTGGAGACGGCCGCCGAGACCGAGGCCCTGATAAGACGGCTCTGCGCCACGGGAATCACGGGGCTCACCGTTCAT
TGCCGGACGACGCCGATGCGGCCGCGCCATCGAGCCATCCGGGACCAGCTGCGCATGGTTGCCCAAGTCTGTCAC
GAGTACGGCGTCGCGTGTCTAATGAATGGCGACGTGGAGAATAGGGACCAGGGCGTCGCGCTGGCTGCAGAGTAC
GGCGCAGACGGGGCCATGATCGCCACGGCGGCCGAGAAGAACCCGTCCTGCTTCAGACCCGAGACCGAAGGGCTA
CTTCCATGGCGAGACGTCGTGTGTCACTACGTAAAGATTGCCATGGGCGTCCACAATCGCTTCGCAAACACAAAG
TTCCTCCTGTCGCATATGATTCCCGGCAAGGAACCGCTCTTCCAGCAGGCTGCCAAAGTCAAGAGTTACAGCCAA
ACTTGCACCATCCTGCAGCTGGATCACCTCGCCGAGCAGGCAGCAGACGTCGACGCGGCCATGGGATTGGATCCG
GCCTACGTCAAGGCGTCGAGGCGAGGGAAATCGAACCCCAGCGCCTTGGCTGCCGGTGGCCACATGGAGCGAACT
CATCCTCGCAAGGCGCTGTCAGACCGTTCCGTCGTCGAGCAGGCGCTGCAAGAGAAGCAAGAGTCGGTTTCTTTG
GCAGCGACTTGA
Gene >Ophun1|7034
ATGCTTGGGCAAGCAGTCAAAGTCCCGATTCCCCGTCGGGGCGTCGATTACCGCGGCAAGATTGTTCTGGCGCCT
ATGGTTCGTTCAGGAGAACTGCCTTCCAGGTTGCTTGCTCTCAGCTGCGGCGCAGACCTCGTCTGGGGTGAGTCG
AATAGATGGTCTCTGAGATGGATCTGAGATGGCATCTCTGACTCAAGACCAGGACCCGAGACGGTCGACCTGTCC
ATGATTGGCACCACCAGACGCTTCAACCATGAGTCCAAGACCATCGAATGGTCTCGTCCCACTTCCCATGGCCCG
ATCGACTCCATCATCTATAGAATGTGTCCAGCCAGGGAAGCAGGAAAGCTCATCTTTCAAATCGGAACGTCGGAT
CCCGAACGCGCCGTCCAGGCAGCCCGACTGGTGGCGGCAGACGTGGCGGGAATCGACGTCAACGCCGGCTGCCCC
AAGCCCTTTAGCACCAGCGGCGGCATGGGCGCGGCCCTCCTCAAAACGCCCGACAAGCTGTGCGCCATTCTCGAG
GCTCTCGTCAGCAACATCACGCCCGAGTATGAGATTGGCATCAGCGTCAAGATTCGCATCTTGGAGACGGCCGCC
GAGACCGAGGCCCTGATAAGACGGCTCTGCGCCACGGGAATCACGGGGCTCACCGTTCATTGCCGGACGACGCCG
ATGCGGCCGCGCCATCGAGCCATCCGGGACCAGCTGCGCATGGTTGCCCAAGTCTGTCACGAGTACGGCGTCGCG
TGTCTAATGAATGGCGACGTGGAGAATAGGGACCAGGGCGTCGCGCTGGCTGCAGAGTACGGCGCAGACGGGGCC
ATGATCGCCACGGCGGCCGAGAAGAACCCGTCCTGCTTCAGACCCGAGACCGAAGGGCTACTTCCATGGCGAGAC
GTCGTGTGTCACTACGTAAAGATTGCCATGGGCGTCCACAATCGCTTCGCAAACACAAAGTTCCTCCTGTCGCAT
ATGATTCCCGGCAAGGAACCGCTCTTCCAGCAGGCTGCCAAAGTCAAGAGTTACAGCCAAACTTGCACCATCCTG
CAGCTGGATCACCTCGCCGAGCAGGCAGCAGACGTCGACGCGGCCATGGGATTGGATCCGGCCTACGTCAAGGCG
TCGAGGCGAGGGAAATCGAACCCCAGCGCCTTGGCTGCCGGTGGCCACATGGAGCGAACTCATCCTCGCAAGGCG
CTGTCAGACCGTTCCGTCGTCGAGCAGGCGCTGCAAGAGAAGCAAGAGTCGGTTTCTTTGGCAGCGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail