Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|703
Gene name
LocationContig_1222:372..3383
Strand+
Gene length (bp)3011
Transcript length (bp)2667
Coding sequence length (bp)2667
Protein length (aa) 889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00755 Carn_acyltransf Choline/Carnitine o-acyltransferase 2.9E-202 47 685

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80235|CACM_YEAST Putative mitochondrial carnitine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAT1 PE=1 SV=2 42 696 8.0E-159
sp|Q5U3U3|CPT2_DANRE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Danio rerio GN=cpt2 PE=2 SV=2 41 672 2.0E-95
sp|P18886|CPT2_RAT Carnitine O-palmitoyltransferase 2, mitochondrial OS=Rattus norvegicus GN=Cpt2 PE=1 SV=1 28 688 5.0E-89
sp|Q60HG9|CPT2_MACFA Carnitine O-palmitoyltransferase 2, mitochondrial OS=Macaca fascicularis GN=CPT2 PE=2 SV=1 37 691 2.0E-86
sp|P23786|CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens GN=CPT2 PE=1 SV=2 37 691 8.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80235|CACM_YEAST Putative mitochondrial carnitine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAT1 PE=1 SV=2 42 696 8.0E-159
sp|Q5U3U3|CPT2_DANRE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Danio rerio GN=cpt2 PE=2 SV=2 41 672 2.0E-95
sp|P18886|CPT2_RAT Carnitine O-palmitoyltransferase 2, mitochondrial OS=Rattus norvegicus GN=Cpt2 PE=1 SV=1 28 688 5.0E-89
sp|Q60HG9|CPT2_MACFA Carnitine O-palmitoyltransferase 2, mitochondrial OS=Macaca fascicularis GN=CPT2 PE=2 SV=1 37 691 2.0E-86
sp|P23786|CPT2_HUMAN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens GN=CPT2 PE=1 SV=2 37 691 8.0E-86
sp|Q2KJB7|CPT2_BOVIN Carnitine O-palmitoyltransferase 2, mitochondrial OS=Bos taurus GN=CPT2 PE=2 SV=1 37 691 4.0E-81
sp|P52825|CPT2_MOUSE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus GN=Cpt2 PE=1 SV=2 32 550 2.0E-79
sp|Q7ZXE1|CPT2_XENLA Carnitine O-palmitoyltransferase 2, mitochondrial OS=Xenopus laevis GN=cpt2 PE=2 SV=1 37 550 1.0E-77
sp|Q6P4X5|CPT2_XENTR Carnitine O-palmitoyltransferase 2, mitochondrial OS=Xenopus tropicalis GN=cpt2 PE=2 SV=1 37 550 1.0E-76
sp|P40017|YAT2_YEAST Carnitine O-acetyltransferase YAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAT2 PE=1 SV=1 33 715 3.0E-68
sp|P32796|CACP_YEAST Carnitine O-acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT2 PE=1 SV=2 28 688 2.0E-67
sp|Q00614|CACP_CANTR Carnitine O-acetyltransferase, mitochondrial OS=Candida tropicalis GN=CAT2 PE=3 SV=1 29 690 3.0E-66
sp|P52826|CACP_COLLI Carnitine O-acetyltransferase OS=Columba livia GN=CRAT PE=1 SV=1 41 700 2.0E-64
sp|P43155|CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens GN=CRAT PE=1 SV=5 39 550 1.0E-63
sp|Q58DK1|CPT1B_BOVIN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Bos taurus GN=CPT1B PE=2 SV=1 11 697 2.0E-63
sp|P32198|CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus GN=Cpt1a PE=1 SV=2 20 673 2.0E-62
sp|P47934|CACP_MOUSE Carnitine O-acetyltransferase OS=Mus musculus GN=Crat PE=1 SV=3 39 694 2.0E-62
sp|P97742|CPT1A_MOUSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus GN=Cpt1a PE=1 SV=4 20 673 6.0E-62
sp|Q704S8|CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus GN=Crat PE=1 SV=1 39 694 5.0E-61
sp|Q924X2|CPT1B_MOUSE Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus GN=Cpt1b PE=1 SV=1 36 702 9.0E-61
sp|Q8HY46|CPT1B_PIG Carnitine O-palmitoyltransferase 1, muscle isoform OS=Sus scrofa GN=CPT1B PE=2 SV=1 36 691 3.0E-60
sp|Q92523|CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens GN=CPT1B PE=1 SV=2 33 691 4.0E-60
sp|Q63704|CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus GN=Cpt1b PE=1 SV=1 36 553 1.0E-59
sp|Q8TCG5|CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens GN=CPT1C PE=1 SV=1 7 553 6.0E-58
sp|P50416|CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens GN=CPT1A PE=1 SV=2 20 673 7.0E-58
sp|Q03059|CLAT_MOUSE Choline O-acetyltransferase OS=Mus musculus GN=Chat PE=2 SV=2 44 550 2.0E-57
sp|Q68Y62|CPT1A_HORSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Equus caballus GN=CPT1A PE=2 SV=1 20 673 6.0E-57
sp|P28329|CLAT_HUMAN Choline O-acetyltransferase OS=Homo sapiens GN=CHAT PE=1 SV=4 4 550 8.0E-56
sp|O19094|OCTC_BOVIN Peroxisomal carnitine O-octanoyltransferase OS=Bos taurus GN=CROT PE=1 SV=1 37 550 2.0E-55
sp|P13222|CLAT_PIG Choline O-acetyltransferase OS=Sus scrofa GN=CHAT PE=1 SV=3 41 550 6.0E-55
sp|P32738|CLAT_RAT Choline O-acetyltransferase OS=Rattus norvegicus GN=Chat PE=1 SV=2 44 550 3.0E-54
sp|P07668|CLAT_DROME Choline O-acetyltransferase OS=Drosophila melanogaster GN=Cha PE=1 SV=3 38 694 3.0E-54
sp|B2ZGJ1|CLAT_DANRE Choline O-acetyltransferase OS=Danio rerio GN=chat PE=2 SV=1 43 550 4.0E-54
sp|F1LN46|CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus GN=Cpt1c PE=1 SV=1 7 691 1.0E-53
sp|Q90YJ9|CLAT_CHICK Choline O-acetyltransferase OS=Gallus gallus GN=CHAT PE=2 SV=1 41 550 3.0E-53
sp|P11466|OCTC_RAT Peroxisomal carnitine O-octanoyltransferase OS=Rattus norvegicus GN=Crot PE=1 SV=3 37 553 7.0E-52
sp|Q8BGD5|CPT1C_MOUSE Carnitine O-palmitoyltransferase 1, brain isoform OS=Mus musculus GN=Cpt1c PE=1 SV=1 7 698 2.0E-51
sp|Q9UKG9|OCTC_HUMAN Peroxisomal carnitine O-octanoyltransferase OS=Homo sapiens GN=CROT PE=1 SV=2 37 553 7.0E-51
sp|Q9DC50|OCTC_MOUSE Peroxisomal carnitine O-octanoyltransferase OS=Mus musculus GN=Crot PE=1 SV=1 37 553 2.0E-50
sp|P32756|CLAT_CAEEL Choline O-acetyltransferase OS=Caenorhabditis elegans GN=cha-1 PE=2 SV=1 41 666 6.0E-41
sp|P75448|Y114_MYCPN Putative acetyltransferase MPN_114 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_114 PE=3 SV=1 38 687 4.0E-25
sp|Q6P4X5|CPT2_XENTR Carnitine O-palmitoyltransferase 2, mitochondrial OS=Xenopus tropicalis GN=cpt2 PE=2 SV=1 615 688 9.0E-08
sp|P52825|CPT2_MOUSE Carnitine O-palmitoyltransferase 2, mitochondrial OS=Mus musculus GN=Cpt2 PE=1 SV=2 615 691 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|703
MVTRSSPHPGDLASPSTAYTRVPMATCDSRPHRCGVTFAAQPSLPKLPIPDLESTCRRYMEALEPLQDARERVQT
RLAVREFLESQGPELQAKLKRYAHDKTSYIEQFWYDAYLNYDNPVVLNLNPFFLLEDDPTPARNNQVTRAASLVI
SALEFVRAVRKEELRPDEFKGKPLCMYQISRLFGTARVPADKGCQIIQDHESQHMVVVCHGQLYWFDVLDRDSDV
VMTERDLALNLQTIIQDAAMTPVQEAAKGALGVLTTENRKVWSGLRKVLTRDAESNNADCLKMVDSALFVLCLDY
TEPADAASLCQNMLCGSSEVKNGVQIGTCTNRWYDKMQIIVCKNGSAGINFEHTGVDGHTVLRFASDVYTDTILR
FARSINGQAPALWTSTSPDPSKKKAKVDTSPRKLEWDLIPELRIAVRFAETRLADLIEQNEFRCLDFAAYGKNFI
TSMGVSPDAFVQMAFQAAYYGLYGRVECTYEPAMTKIFLHGRTEAIRSVSPESVDFVQTFWGDHGADKKLAALRR
ACQKHVDRTRDCSKAQGCDRHLFALLCVWQKCVDGEEDVEGDDESSAPSSPAVAIESNPNCATPVESPVEARSRN
NSSATARSRDSQHLLPALFADAGWDKLNTAVLSTSNCGNPSLRHFGFGPTSGDGFGIGYIIKDDSISICVSSKHR
QTKRFVDTLESYLLEMRRMHRLATRKSSAAVHVSEPPPMEPRSRQKSRGRLLTGTEAARIARLADAVYRPEDSCV
TTEAGGDDVDQDDDELGGYGFFDAGMLLQALKARNSGDMTVDEMRASERAVAQARRSASNVDPNLLHGPTRTPLR
NPSKPLMTDLVRILPSFPIGSFSNLLTTIENKGLSTADLLALHAVDIAKETRLPVLDSWTFSR*
Coding >Ophun1|703
ATGGTGACAAGATCCTCCCCCCATCCCGGCGACCTCGCCAGCCCCTCGACCGCCTATACCCGCGTCCCCATGGCC
ACCTGCGACTCCCGCCCCCATCGCTGCGGCGTCACCTTCGCCGCCCAGCCCTCCCTCCCCAAGCTGCCCATCCCG
GACCTCGAGAGCACCTGTCGTCGGTACATGGAGGCCCTCGAGCCGCTGCAGGATGCCCGCGAAAGGGTCCAGACT
CGCCTCGCCGTCCGCGAGTTTCTCGAGTCGCAGGGTCCGGAGCTGCAGGCCAAGCTGAAGCGCTATGCTCACGAC
AAGACGAGCTATATCGAGCAGTTCTGGTACGACGCCTACCTCAACTACGACAACCCCGTCGTCCTCAACCTCAAC
CCCTTCTTCCTCCTCGAAGACGACCCGACGCCAGCCCGCAACAACCAAGTCACCCGCGCCGCCTCCCTCGTCATC
TCCGCCCTCGAGTTCGTCCGCGCCGTCCGCAAAGAGGAGCTCCGTCCCGATGAGTTCAAGGGCAAGCCGCTGTGC
ATGTACCAGATCTCGCGCCTGTTCGGCACCGCCCGCGTGCCCGCCGACAAGGGCTGTCAGATCATCCAGGACCAC
GAGTCGCAGCACATGGTCGTCGTCTGCCATGGCCAGCTGTACTGGTTCGACGTGCTGGACCGCGACTCGGACGTC
GTCATGACGGAGAGAGACCTGGCCCTTAACCTGCAGACCATCATCCAGGACGCCGCCATGACGCCCGTCCAGGAG
GCGGCAAAGGGAGCCCTCGGCGTGCTGACGACGGAGAACCGCAAGGTCTGGTCCGGCCTGCGAAAGGTGCTGACG
CGCGATGCCGAGTCCAATAACGCCGACTGCCTCAAAATGGTCGATTCAGCCCTCTTCGTCCTCTGCCTCGACTAC
ACCGAGCCCGCCGATGCGGCCTCCCTCTGCCAGAACATGCTCTGCGGCTCCAGCGAGGTCAAGAACGGCGTCCAG
ATCGGCACCTGCACCAACCGCTGGTACGACAAGATGCAGATCATCGTCTGCAAGAACGGCAGCGCCGGTATCAAC
TTTGAGCACACGGGCGTCGACGGCCACACCGTCCTCCGCTTCGCCAGCGACGTCTATACCGACACCATCCTGCGC
TTCGCCCGCTCCATCAACGGCCAGGCTCCGGCCCTGTGGACATCGACGAGTCCAGATCCGTCCAAGAAGAAGGCC
AAGGTCGACACCAGCCCGCGTAAGCTGGAATGGGACCTGATCCCCGAGCTGCGCATCGCCGTCCGCTTCGCCGAG
ACGAGGCTGGCAGACCTCATCGAGCAAAACGAGTTCCGCTGTCTCGACTTCGCCGCCTATGGCAAGAACTTCATC
ACCTCCATGGGCGTCTCGCCCGATGCCTTTGTGCAGATGGCCTTCCAAGCCGCCTACTACGGCCTATACGGACGC
GTCGAGTGCACGTACGAGCCGGCCATGACCAAGATCTTCCTGCACGGCCGCACCGAGGCCATCCGCTCCGTCTCG
CCCGAGTCGGTCGACTTCGTCCAGACCTTTTGGGGCGATCACGGGGCCGACAAGAAGCTGGCTGCCCTACGCCGC
GCCTGTCAGAAGCACGTCGACAGGACCAGGGACTGCTCCAAGGCCCAGGGCTGCGACCGTCACCTGTTTGCCCTG
CTCTGCGTCTGGCAAAAGTGCGTCGACGGCGAGGAAGACGTCGAAGGAGACGACGAGAGCAGTGCCCCGTCCAGT
CCGGCCGTCGCCATCGAGAGCAATCCCAACTGCGCAACACCCGTCGAGAGTCCCGTCGAAGCCCGCTCCCGCAAC
AACAGCAGCGCGACGGCCCGGTCCAGAGACAGCCAACACCTCCTACCGGCCCTCTTCGCCGACGCCGGCTGGGAC
AAGCTCAACACGGCCGTGCTGTCGACATCCAACTGCGGCAACCCGTCGCTGCGGCACTTCGGCTTCGGTCCCACC
TCGGGCGATGGCTTCGGCATCGGCTACATCATCAAGGACGACTCCATCTCCATCTGCGTCTCCAGCAAGCACCGG
CAGACGAAGCGCTTCGTCGACACGCTCGAGAGTTACCTGCTCGAAATGCGCCGAATGCACCGCCTCGCCACCCGC
AAGTCGTCGGCAGCCGTCCACGTCAGCGAGCCGCCGCCAATGGAGCCGAGGAGCAGACAAAAGTCCCGCGGGCGT
CTCCTCACGGGCACCGAGGCCGCCCGGATAGCACGCCTCGCCGACGCCGTCTACCGGCCAGAGGACAGCTGCGTC
ACGACCGAAGCCGGCGGCGACGACGTGGACCAGGATGATGACGAGCTGGGCGGATATGGCTTCTTTGACGCCGGC
ATGCTTCTCCAGGCGCTCAAGGCGAGGAACTCGGGTGACATGACGGTCGATGAGATGAGAGCCTCGGAGAGAGCT
GTTGCTCAAGCCCGACGCAGCGCCAGCAACGTCGATCCAAACCTCCTTCATGGCCCAACCAGGACGCCTCTCCGC
AATCCCTCAAAACCTCTCATGACCGACCTCGTCCGCATCCTACCATCCTTTCCCATAGGCTCCTTCTCCAACCTG
CTCACCACCATCGAGAACAAAGGCCTCAGCACAGCCGACCTCCTGGCGCTGCACGCCGTCGACATCGCCAAGGAG
ACGCGTCTGCCGGTTCTCGACTCTTGGACCTTTTCACGATGA
Transcript >Ophun1|703
ATGGTGACAAGATCCTCCCCCCATCCCGGCGACCTCGCCAGCCCCTCGACCGCCTATACCCGCGTCCCCATGGCC
ACCTGCGACTCCCGCCCCCATCGCTGCGGCGTCACCTTCGCCGCCCAGCCCTCCCTCCCCAAGCTGCCCATCCCG
GACCTCGAGAGCACCTGTCGTCGGTACATGGAGGCCCTCGAGCCGCTGCAGGATGCCCGCGAAAGGGTCCAGACT
CGCCTCGCCGTCCGCGAGTTTCTCGAGTCGCAGGGTCCGGAGCTGCAGGCCAAGCTGAAGCGCTATGCTCACGAC
AAGACGAGCTATATCGAGCAGTTCTGGTACGACGCCTACCTCAACTACGACAACCCCGTCGTCCTCAACCTCAAC
CCCTTCTTCCTCCTCGAAGACGACCCGACGCCAGCCCGCAACAACCAAGTCACCCGCGCCGCCTCCCTCGTCATC
TCCGCCCTCGAGTTCGTCCGCGCCGTCCGCAAAGAGGAGCTCCGTCCCGATGAGTTCAAGGGCAAGCCGCTGTGC
ATGTACCAGATCTCGCGCCTGTTCGGCACCGCCCGCGTGCCCGCCGACAAGGGCTGTCAGATCATCCAGGACCAC
GAGTCGCAGCACATGGTCGTCGTCTGCCATGGCCAGCTGTACTGGTTCGACGTGCTGGACCGCGACTCGGACGTC
GTCATGACGGAGAGAGACCTGGCCCTTAACCTGCAGACCATCATCCAGGACGCCGCCATGACGCCCGTCCAGGAG
GCGGCAAAGGGAGCCCTCGGCGTGCTGACGACGGAGAACCGCAAGGTCTGGTCCGGCCTGCGAAAGGTGCTGACG
CGCGATGCCGAGTCCAATAACGCCGACTGCCTCAAAATGGTCGATTCAGCCCTCTTCGTCCTCTGCCTCGACTAC
ACCGAGCCCGCCGATGCGGCCTCCCTCTGCCAGAACATGCTCTGCGGCTCCAGCGAGGTCAAGAACGGCGTCCAG
ATCGGCACCTGCACCAACCGCTGGTACGACAAGATGCAGATCATCGTCTGCAAGAACGGCAGCGCCGGTATCAAC
TTTGAGCACACGGGCGTCGACGGCCACACCGTCCTCCGCTTCGCCAGCGACGTCTATACCGACACCATCCTGCGC
TTCGCCCGCTCCATCAACGGCCAGGCTCCGGCCCTGTGGACATCGACGAGTCCAGATCCGTCCAAGAAGAAGGCC
AAGGTCGACACCAGCCCGCGTAAGCTGGAATGGGACCTGATCCCCGAGCTGCGCATCGCCGTCCGCTTCGCCGAG
ACGAGGCTGGCAGACCTCATCGAGCAAAACGAGTTCCGCTGTCTCGACTTCGCCGCCTATGGCAAGAACTTCATC
ACCTCCATGGGCGTCTCGCCCGATGCCTTTGTGCAGATGGCCTTCCAAGCCGCCTACTACGGCCTATACGGACGC
GTCGAGTGCACGTACGAGCCGGCCATGACCAAGATCTTCCTGCACGGCCGCACCGAGGCCATCCGCTCCGTCTCG
CCCGAGTCGGTCGACTTCGTCCAGACCTTTTGGGGCGATCACGGGGCCGACAAGAAGCTGGCTGCCCTACGCCGC
GCCTGTCAGAAGCACGTCGACAGGACCAGGGACTGCTCCAAGGCCCAGGGCTGCGACCGTCACCTGTTTGCCCTG
CTCTGCGTCTGGCAAAAGTGCGTCGACGGCGAGGAAGACGTCGAAGGAGACGACGAGAGCAGTGCCCCGTCCAGT
CCGGCCGTCGCCATCGAGAGCAATCCCAACTGCGCAACACCCGTCGAGAGTCCCGTCGAAGCCCGCTCCCGCAAC
AACAGCAGCGCGACGGCCCGGTCCAGAGACAGCCAACACCTCCTACCGGCCCTCTTCGCCGACGCCGGCTGGGAC
AAGCTCAACACGGCCGTGCTGTCGACATCCAACTGCGGCAACCCGTCGCTGCGGCACTTCGGCTTCGGTCCCACC
TCGGGCGATGGCTTCGGCATCGGCTACATCATCAAGGACGACTCCATCTCCATCTGCGTCTCCAGCAAGCACCGG
CAGACGAAGCGCTTCGTCGACACGCTCGAGAGTTACCTGCTCGAAATGCGCCGAATGCACCGCCTCGCCACCCGC
AAGTCGTCGGCAGCCGTCCACGTCAGCGAGCCGCCGCCAATGGAGCCGAGGAGCAGACAAAAGTCCCGCGGGCGT
CTCCTCACGGGCACCGAGGCCGCCCGGATAGCACGCCTCGCCGACGCCGTCTACCGGCCAGAGGACAGCTGCGTC
ACGACCGAAGCCGGCGGCGACGACGTGGACCAGGATGATGACGAGCTGGGCGGATATGGCTTCTTTGACGCCGGC
ATGCTTCTCCAGGCGCTCAAGGCGAGGAACTCGGGTGACATGACGGTCGATGAGATGAGAGCCTCGGAGAGAGCT
GTTGCTCAAGCCCGACGCAGCGCCAGCAACGTCGATCCAAACCTCCTTCATGGCCCAACCAGGACGCCTCTCCGC
AATCCCTCAAAACCTCTCATGACCGACCTCGTCCGCATCCTACCATCCTTTCCCATAGGCTCCTTCTCCAACCTG
CTCACCACCATCGAGAACAAAGGCCTCAGCACAGCCGACCTCCTGGCGCTGCACGCCGTCGACATCGCCAAGGAG
ACGCGTCTGCCGGTTCTCGACTCTTGGACCTTTTCACGATGA
Gene >Ophun1|703
ATGGTGACAAGATCCTCCCCCCATCCCGGCGACCTCGCCAGCCCCTCGACCGCCTATACCCGCGTCCCCATGGCC
ACCTGCGACTCCCGCCCCCATCGCTGCGGCGTCACCTTCGCCGCCCAGCCCTCCCTCCCCAAGCTGCCCATCCCG
GACCTCGAGAGCACCTGTCGTCGGTACATGGAGGCCCTCGAGCCGCTGCAGGATGCCCGCGAAAGGGTCCAGACT
CGCCTCGCCGTCCGCGAGTTTCTCGAGTCGCAGGGTCCGGAGCTGCAGGCCAAGCTGAAGCGCTATGCTCACGAC
AAGACGAGCTATATCGAGCAGTTCTGTCAGACTCACTCAGTATATCCCTGACTGCGAGCAACCAAGTCTAACCCT
TCTTCTTCTTCATCTCTCAGGGTACGACGCCTACCTCAACTACGACAACCCCGTCGTCCTCAACCTCAACCCCTT
CTTCCTCCTCGAAGACGACCCGACGCCAGCCCGCAACAACCAAGTCACCCGCGCCGCCTCCCTCGTCATCTCCGC
CCTCGAGTTCGTCCGCGCCGTCCGCAAAGAGGAGCTCCGTCCCGATGAGTTCAAGGGCAAGCCGCTGTGCATGTA
CCAGATCTCGCGCCTGTTCGGCACCGCCCGCGTGCCCGCCGACAAGGGCTGTCAGATCATCCAGGACCACGAGTC
GCAGCACATGGTCGTCGTCTGCCATGGCCAGCTGTACTGGTTCGACGTGCTGGACCGCGACTCGGACGTCGTCAT
GACGGAGAGAGACCTGGCCCTTAACCTGCAGACCATCATCCAGGACGCCGCCATGACGCCCGTCCAGGAGGCGGC
AAAGGGAGCCCTCGGCGTGCTGACGACGGAGAACCGCAAGGTCTGGTCCGGCCTGCGAAAGGTGCTGACGCGCGA
TGCCGAGTCCAATAACGCCGACTGCCTCAAAATGGTCGATTCAGCCCTCTTCGTCCTCTGCCTCGACTACACCGA
GCCCGCCGATGCGGCCTCCCTCTGCCAGAACATGCTCTGCGGCTCCAGCGAGGTCAAGAACGGCGTCCAGATCGG
CACCTGCACCAACCGCTGGTACGACAAGATGCAGATCATCGTCTGCAAGAACGGCAGCGCCGGTATCAACTTTGA
GCACACGGGCGTCGACGGCCACACCGTCCTCCGCTTCGCCAGCGACGTCTATACCGACACCATCCTGCGCTTCGC
CCGCTCCATCAACGGCCAGGCTCCGGCCCTGTGGACATCGACGAGTCCAGATCCGTCCAAGAAGAAGGCCAAGGT
CGACACCAGCCCGCGTAAGCTGGAATGGGACCTGATCCCCGAGCTGCGCATCGCCGTCCGCTTCGCCGAGACGAG
GCTGGCAGACCTCATCGAGCAAAACGAGTTCCGCTGTCTCGACTTCGCCGCCTATGGCAAGAACTTCATCACCTC
CATGGGCGTCTCGCCCGATGCCTTTGTGCAGATGGCCTTCCAAGCCGCCTACTACGGCCTATACGGACGCGTCGA
GTGCACGTACGAGCCGGCCATGACCAAGATCTTCCTGCACGGCCGCACCGAGGCCATCCGCTCCGTCTCGCCCGA
GTCGGTCGACTTCGTCCAGACCTTTTGGGGCGATCACGGGGCCGACAAGAAGCTGGCTGCCCTACGCCGCGCCTG
TCAGAAGCACGTCGACAGGACCAGGGACTGCTCCAAGGCCCAGGGCTGCGACCGTCACCTGTTTGCCCTGCTCTG
CGTCTGGCAAAAGTGCGTCGACGGCGAGGAAGACGTCGAAGGAGACGACGAGAGCAGTGCCCCGTCCAGTCCGGC
CGTCGCCATCGAGAGCAATCCCAACTGCGCAACACCCGTCGAGAGTCCCGTCGAAGCCCGCTCCCGCAACAACAG
CAGCGCGACGGCCCGGTCCAGAGACAGCCAACACCTCCTACCGGCCCTCTTCGCCGACGCCGGCTGGGACAAGCT
CAACACGGCCGTGCTGTCGACATCCAACTGCGGCAACCCGTCGCTGCGGCACTTCGGCTTCGGTCCCACCTCGGG
CGATGGCTTCGGCATCGGCTACATCATCAAGGACGACTCCATCTCCATCTGCGTCTCCAGCAAGCACCGGCAGAC
GAAGCGCTTCGTCGACACGCTCGAGAGTTACCTGCTCGAAATGCGCCGAATGCACCGCCTCGCCACCCGCAAGTC
GTCGGCAGCCGTCCACGTCAGCGAGCCGCCGCCAATGGAGCCGAGGAGCAGACAAAAGTCCCGCGGGCGTCTCCT
CACGGGCACCGAGGCCGCCCGGATAGCACGCCTCGCCGACGCCGTCTACCGGCCAGAGGACAGCTGCGTCACGAC
CGAAGCCGGCGGCGACGACGTGGACCAGGATGATGACGAGCTGGGCGGATGTAAGTCTCGAGTGATCATCTTCTT
GCAACCCTGTTTGCTGACCACCATCCGTCGTCTGCAGATGGCTTCTTTGACGCCGGCATGCTTCTCCAGGCGCTC
AAGGCGAGGAACTCGGGTGACATGACGGTCGATGAGATGAGAGCCTCGGAGAGAGCTGTTGCTCAAGCCCGACGT
AGGACAGTAGGTAAGAAGCTGCGGCTGGCCACTGAATGAGAATCTTGATATCTCGTGTCTCCGCTCTTGTAGGTA
GAAAACAGGCACGTGATTCTCGCGATAACTTCCCGCCCTTGTTCACGTCACCACTCAGGCTCTAGGGTAGGCAGC
GCCAGCAACGTCGATCCAAACCTCCTTCATGGCCCAACCAGGACGCCTCTCCGCAATCCCTCAAAACCTCTCATG
ACCGACCTCGTCCGCATCCTACCATCCTTTCCCATAGGCTCCTTCTCCAACCTGCTCACCACCATCGAGAACAAA
GGCCTCAGCACAGCCGACCTCCTGGCGCTGCACGCCGTCGACATCGCCAAGGAGACGCGTCTGCCGGTTCTCGAC
GTGCGGCGCTTGGTGGCGGCTATCCAGGCGTCGCTGGTGGATGATGTTGCCGTCGAGGAGCTCAGTCTTGGACCT
TTTCACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail