Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7025
Gene name
LocationContig_83:2302..4369
Strand-
Gene length (bp)2067
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05064 Nsp1_C Nsp1-like C-terminal region 7.0E-39 399 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 390 639 5.0E-102
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 414 613 4.0E-31
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 397 613 3.0E-30
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 407 613 1.0E-29
sp|P14907|NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSP1 PE=1 SV=1 304 613 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 390 639 5.0E-102
sp|P37198|NUP62_HUMAN Nuclear pore glycoprotein p62 OS=Homo sapiens GN=NUP62 PE=1 SV=3 414 613 4.0E-31
sp|Q63850|NUP62_MOUSE Nuclear pore glycoprotein p62 OS=Mus musculus GN=Nup62 PE=1 SV=2 397 613 3.0E-30
sp|P17955|NUP62_RAT Nuclear pore glycoprotein p62 OS=Rattus norvegicus GN=Nup62 PE=1 SV=1 407 613 1.0E-29
sp|P14907|NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSP1 PE=1 SV=1 304 613 1.0E-27
sp|Q8L7F7|NUP62_ARATH Nuclear pore complex protein NUP62 OS=Arabidopsis thaliana GN=NUP62 PE=1 SV=1 390 608 5.0E-18
sp|G0SBQ3|NSP1_CHATD Nucleoporin NSP1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NSP1 PE=1 SV=1 1 184 4.0E-10
sp|Q9H1M0|N62CL_HUMAN Nucleoporin-62 C-terminal-like protein OS=Homo sapiens GN=NUP62CL PE=1 SV=3 407 497 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4588
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|7655
Ophiocordyceps camponoti-floridani Ophcf2|00420
Ophiocordyceps camponoti-rufipedis Ophun1|7025 (this protein)
Ophiocordyceps kimflemingae Ophio5|6341
Ophiocordyceps subramaniannii Hirsu2|9631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7025
MAFSFGTPSSSAQPSDATTTTAPATGNLFGAAAAPTTSSFSFGSKANTMAPGTGSEQQQQQQTAAGDAQKPAAAS
STTAPSFGSASTLVGSNLFGGSNTTSTPPAGSLFGSVASKPATNLFGAPAATGGGFFGSQNTDQANALTTTTPAK
PMFSLASTTPAGAPPADSSGAAASSSQTTAPSSTQGLFSLGLGNAGSNATSGGDSASAFKTVAPAAGGLLGNAGS
SSAPATEGSAAPATANSLFDYHQRKPVQHHVGSYGQYLRSSTDYFIAIYWFVWEHAAICRRHCRANYGVVTLWSS
CRHYCFAADVGIGDHTDRGRTSGALFAAKPAAEGSANQTAGGLFGAKTTTDGGGATQTAGSLFGAKSATEGADKD
KAQDGQAAKPAAQNVTTNALGASTSGPTSQIPRLKNKTMEDIITRWASDLAKYQKDFKEQATVVSTWDRNLVENG
EKIQKLYLDTFEAERASHEIERQLVAVESQQDELEAWLDRYEAEVQDMFVKQVGPGEQLAGPDQERERTYKLAEK
LTQQLDEKSRDLSKMVKEINEISGSLTKGAKVEDPVSISSFLSLSTYVSDCNDKLSQVVRVLNGHLTQLQWIDAN
AAALQAKVAAAQKSSGALNSHYVGVENDAAETFYRSYMGRR*
Coding >Ophun1|7025
ATGGCCTTTAGCTTCGGAACGCCCAGCTCGTCGGCCCAGCCGTCAGACGCGACGACGACAACGGCGCCCGCTACC
GGCAATCTCTTCGGCGCTGCGGCGGCTCCTACGACGTCTTCCTTCTCCTTCGGAAGCAAGGCAAACACTATGGCT
CCTGGTACTGGTTCAGAGCAGCAGCAGCAGCAGCAGACGGCCGCTGGAGACGCGCAGAAGCCTGCTGCTGCTTCT
TCGACCACGGCGCCGTCTTTCGGCTCGGCCTCCACCTTGGTTGGCAGCAATCTCTTTGGCGGTTCGAATACGACG
TCAACGCCCCCGGCTGGAAGCCTTTTTGGAAGCGTGGCCAGCAAGCCAGCCACGAACCTCTTCGGTGCTCCCGCT
GCCACTGGCGGCGGCTTCTTCGGTTCGCAAAACACTGATCAGGCCAACGCGCTCACGACGACGACTCCTGCTAAA
CCCATGTTTTCTCTCGCCTCGACGACTCCAGCAGGGGCTCCTCCAGCTGACTCTTCGGGTGCCGCCGCTTCCTCT
TCGCAAACCACGGCTCCCTCGTCCACTCAGGGACTCTTCAGCCTCGGGCTCGGAAACGCGGGCAGCAATGCCACT
TCTGGCGGAGACAGCGCCTCAGCCTTCAAGACTGTGGCACCTGCGGCAGGGGGCCTGCTCGGGAACGCAGGTAGC
AGTTCGGCGCCGGCGACGGAAGGTTCTGCAGCTCCCGCAACGGCAAATTCCCTATTTGACTACCACCAGCGGAAG
CCTGTTCAGCACCACGTCGGCTCCTACGGCCAATATCTCCGCAGCAGCACCGACTACTTCATTGCCATCTACTGG
TTTGTTTGGGAGCACGCAGCCATCTGCCGCCGCCACTGCCGCGCCAACTACGGCGTCGTCACTCTTTGGAGCTCC
TGCCGCCACTACTGCTTCGCAGCCGACGTCGGCATCGGGGATCACACAGACCGCGGGCGGACCTCGGGCGCGCTG
TTCGCAGCCAAGCCGGCCGCGGAGGGCAGCGCAAACCAGACCGCAGGCGGGTTATTTGGGGCCAAGACTACGACC
GACGGCGGCGGCGCAACCCAGACGGCCGGCTCGCTGTTCGGTGCCAAGTCGGCCACCGAGGGTGCGGACAAGGAT
AAGGCTCAGGACGGTCAGGCTGCCAAACCTGCAGCCCAAAATGTGACAACGAACGCGTTGGGCGCCTCGACAAGC
GGTCCGACCTCGCAGATACCGCGACTGAAGAACAAAACCATGGAGGACATCATCACTCGATGGGCTTCGGATCTT
GCCAAGTATCAGAAGGATTTCAAAGAACAGGCCACAGTGGTGTCGACGTGGGATCGAAACCTCGTCGAGAATGGA
GAAAAGATTCAGAAGCTGTATCTCGACACTTTTGAGGCTGAGAGGGCGAGTCACGAAATCGAGCGACAACTAGTG
GCGGTGGAGAGCCAGCAGGACGAGCTCGAGGCTTGGCTGGATCGGTACGAGGCAGAGGTTCAGGACATGTTTGTC
AAGCAGGTCGGCCCGGGCGAGCAGCTGGCCGGTCCGGACCAGGAGCGGGAGCGAACCTACAAGCTGGCCGAGAAG
CTCACGCAGCAGCTCGACGAGAAGTCGCGAGACCTCTCCAAGATGGTCAAGGAGATCAACGAAATTTCGGGGAGC
CTGACCAAGGGGGCCAAGGTCGAGGACCCTGTGAGCATATCTTCCTTCTTGAGTCTGTCAACTTATGTTTCTGAC
TGTAACGACAAGCTGAGCCAAGTGGTGCGCGTCCTCAACGGTCATCTCACCCAGCTGCAATGGATCGACGCCAAC
GCCGCGGCACTGCAGGCCAAGGTGGCGGCGGCGCAGAAGTCAAGCGGCGCGTTGAACAGCCACTACGTCGGAGTA
GAGAACGACGCGGCAGAGACCTTCTATCGATCTTACATGGGCCGACGATGA
Transcript >Ophun1|7025
ATGGCCTTTAGCTTCGGAACGCCCAGCTCGTCGGCCCAGCCGTCAGACGCGACGACGACAACGGCGCCCGCTACC
GGCAATCTCTTCGGCGCTGCGGCGGCTCCTACGACGTCTTCCTTCTCCTTCGGAAGCAAGGCAAACACTATGGCT
CCTGGTACTGGTTCAGAGCAGCAGCAGCAGCAGCAGACGGCCGCTGGAGACGCGCAGAAGCCTGCTGCTGCTTCT
TCGACCACGGCGCCGTCTTTCGGCTCGGCCTCCACCTTGGTTGGCAGCAATCTCTTTGGCGGTTCGAATACGACG
TCAACGCCCCCGGCTGGAAGCCTTTTTGGAAGCGTGGCCAGCAAGCCAGCCACGAACCTCTTCGGTGCTCCCGCT
GCCACTGGCGGCGGCTTCTTCGGTTCGCAAAACACTGATCAGGCCAACGCGCTCACGACGACGACTCCTGCTAAA
CCCATGTTTTCTCTCGCCTCGACGACTCCAGCAGGGGCTCCTCCAGCTGACTCTTCGGGTGCCGCCGCTTCCTCT
TCGCAAACCACGGCTCCCTCGTCCACTCAGGGACTCTTCAGCCTCGGGCTCGGAAACGCGGGCAGCAATGCCACT
TCTGGCGGAGACAGCGCCTCAGCCTTCAAGACTGTGGCACCTGCGGCAGGGGGCCTGCTCGGGAACGCAGGTAGC
AGTTCGGCGCCGGCGACGGAAGGTTCTGCAGCTCCCGCAACGGCAAATTCCCTATTTGACTACCACCAGCGGAAG
CCTGTTCAGCACCACGTCGGCTCCTACGGCCAATATCTCCGCAGCAGCACCGACTACTTCATTGCCATCTACTGG
TTTGTTTGGGAGCACGCAGCCATCTGCCGCCGCCACTGCCGCGCCAACTACGGCGTCGTCACTCTTTGGAGCTCC
TGCCGCCACTACTGCTTCGCAGCCGACGTCGGCATCGGGGATCACACAGACCGCGGGCGGACCTCGGGCGCGCTG
TTCGCAGCCAAGCCGGCCGCGGAGGGCAGCGCAAACCAGACCGCAGGCGGGTTATTTGGGGCCAAGACTACGACC
GACGGCGGCGGCGCAACCCAGACGGCCGGCTCGCTGTTCGGTGCCAAGTCGGCCACCGAGGGTGCGGACAAGGAT
AAGGCTCAGGACGGTCAGGCTGCCAAACCTGCAGCCCAAAATGTGACAACGAACGCGTTGGGCGCCTCGACAAGC
GGTCCGACCTCGCAGATACCGCGACTGAAGAACAAAACCATGGAGGACATCATCACTCGATGGGCTTCGGATCTT
GCCAAGTATCAGAAGGATTTCAAAGAACAGGCCACAGTGGTGTCGACGTGGGATCGAAACCTCGTCGAGAATGGA
GAAAAGATTCAGAAGCTGTATCTCGACACTTTTGAGGCTGAGAGGGCGAGTCACGAAATCGAGCGACAACTAGTG
GCGGTGGAGAGCCAGCAGGACGAGCTCGAGGCTTGGCTGGATCGGTACGAGGCAGAGGTTCAGGACATGTTTGTC
AAGCAGGTCGGCCCGGGCGAGCAGCTGGCCGGTCCGGACCAGGAGCGGGAGCGAACCTACAAGCTGGCCGAGAAG
CTCACGCAGCAGCTCGACGAGAAGTCGCGAGACCTCTCCAAGATGGTCAAGGAGATCAACGAAATTTCGGGGAGC
CTGACCAAGGGGGCCAAGGTCGAGGACCCTGTGAGCATATCTTCCTTCTTGAGTCTGTCAACTTATGTTTCTGAC
TGTAACGACAAGCTGAGCCAAGTGGTGCGCGTCCTCAACGGTCATCTCACCCAGCTGCAATGGATCGACGCCAAC
GCCGCGGCACTGCAGGCCAAGGTGGCGGCGGCGCAGAAGTCAAGCGGCGCGTTGAACAGCCACTACGTCGGAGTA
GAGAACGACGCGGCAGAGACCTTCTATCGATCTTACATGGGCCGACGATGA
Gene >Ophun1|7025
ATGGCCTTTAGCTTCGGAACGCCCAGCTCGTCGGCCCAGCCGTCAGACGCGACGACGACAACGGCGCCCGCTACC
GGCAATCTCTTCGGCGCTGCGGCGGCTCCTACGACGTCTTCCTTCTCCTTCGGAAGCAAGGCAAACACTATGGCT
CCTGGTACTGGTTCAGAGCAGCAGCAGCAGCAGCAGACGGCCGCTGGAGACGCGCAGAAGCCTGCTGCTGCTTCT
TCGACCACGGCGCCGTCTTTCGGCTCGGCCTCCACCTTGGTTGGCAGCAATCTCTTTGGCGGTTCGAATACGACG
TCAACGCCCCCGGCTGGAAGCCTTTTTGGAAGCGTGGCCAGCAAGCCAGCCACGAACCTCTTCGGTGCTCCCGCT
GCCACTGGCGGCGGCTTCTTCGGTTCGCAAAACACTGATCAGGCCAACGCGCTCACGACGACGACTCCTGCTAAA
CCCATGTTTTCTCTCGCCTCGACGACTCCAGCAGGGGCTCCTCCAGCTGACTCTTCGGGTGCCGCCGCTTCCTCT
TCGCAAACCACGGCTCCCTCGTCCACTCAGGGACTCTTCAGCCTCGGGCTCGGAAACGCGGGCAGCAATGCCACT
TCTGGCGGAGACAGCGCCTCAGCCTTCAAGACTGTGGCACCTGCGGCAGGGGGCCTGCTCGGGAACGCAGGTAGC
AGTTCGGCGCCGGCGACGGAAGGTTCTGCAGCTCCCGCAACGGCAAATTCCCTATTTGGTACTTTGAAGCCAGCG
GCTGGAGCCACGACGACCGGAGCTGGGCTTTTTGGCAACCCTGCGGCTGCCTCTACCGCCTCGACAACTGACGCC
ACCAAGACTACCACCAGCGGAAGCCTGTTCAGCACCACGTCGGCTCCTACGGCCAATATCTCCGCAGCAGCACCG
ACTACTTCATTGCCATCTACTGGTTTGTTTGGGAGCACGCAGCCATCTGCCGCCGCCACTGCCGCGCCAACTACG
GCGTCGTCACTCTTTGGAGCTCCTGCCGCCACTACTGCTTCGCAGCCGACGTCGGCATCGGGGATCACACAGACC
GCGGGCGGGTTGTTTGGCGCCAAGCCGACGACTGACGGTGGCGCAACCCAGACCTCGGGCGCGCTGTTCGCAGCC
AAGCCGGCCGCGGAGGGCAGCGCAAACCAGACCGCAGGCGGGTTATTTGGGGCCAAGACTACGACCGACGGCGGC
GGCGCAACCCAGACGGCCGGCTCGCTGTTCGGTGCCAAGTCGGCCACCGAGGGTGCGGACAAGGATAAGGCTCAG
GACGGTCAGGCTGCCAAACCTGCAGCCCAAAATGTGACAACGAACGCGTTGGGCGCCTCGACAAGCGGTCCGACC
TCGCAGATACCGCGACTGAAGAACAAAACCATGGAGGACATCATCACTCGATGGGCTTCGGATCTTGCCAAGTAT
CAGAAGGATTTCAAAGAACAGGCCACAGTGGTGTCGACGTGGGATCGAAACCTCGTCGAGAATGGAGAAAAGATT
CAGAAGCTGTATCTCGACACTTTTGAGGCTGAGAGGGCGAGTCACGAAATCGAGCGACAACTAGTGGCGGTGGAG
AGCCAGCAGGACGAGCTCGAGGCTTGGCTGGATCGGTACGAGGCAGAGGTTCAGGACATGTTTGTCAAGCAGGTC
GGCCCGGGCGAGCAGCTGGCCGGTCCGGACCAGGAGCGGGAGCGAACCTACAAGCTGGCCGAGAAGCTCACGCAG
CAGCTCGACGAGAAGTCGCGAGACCTCTCCAAGATGGTCAAGGAGATCAACGAAATTTCGGGGAGCCTGACCAAG
GGGGCCAAGGTCGAGGACCCTGTGAGCATATCTTCCTTCTTGAGTCTGTCAACTTATGTTTCTGACTGTAACGAC
AAGCTGAGCCAAGTGGTGCGCGTCCTCAACGGTCATCTCACCCAGCTGCAATGGATCGACGCCAACGCCGCGGCA
CTGCAGGCCAAGGTGGCGGCGGCGCAGAAGTCAAGCGGCGCGTTGAACAGCCACTACGTCGGAGTAGAGAACGAC
GCGGCAGAGACCTTCTATCGATCTTACATGGGCCGACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail