Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7012
Gene name
LocationContig_825:1538..1793
Strand+
Gene length (bp)255
Transcript length (bp)255
Coding sequence length (bp)255
Protein length (aa) 85

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4970
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|332
Ophiocordyceps australis map64 (Brazil) OphauB2|5313
Ophiocordyceps camponoti-floridani Ophcf2|02050
Ophiocordyceps camponoti-floridani Ophcf2|07439
Ophiocordyceps camponoti-rufipedis Ophun1|7012 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7012
MSSTAMEAPVSSPLHSRTSSTATTTTTTSSSLTAATTAPATMQSSPPPPPSTSDLLRDLTLVAEAAKRAQVAVLV
RDFEDCGLA*
Coding >Ophun1|7012
ATGTCGAGCACCGCCATGGAAGCCCCCGTCTCATCACCGCTACACTCCCGCACGTCGTCAACGGCCACAACCACG
ACGACAACCTCATCATCATTAACGGCAGCAACAACCGCCCCCGCCACAATGCAGTCCTCGCCTCCGCCCCCGCCC
TCGACCTCGGATCTCCTCCGCGACCTCACCCTCGTCGCCGAAGCCGCAAAGCGCGCCCAGGTAGCCGTCCTCGTC
CGCGACTTTGAGGACTGTGGCCTCGCTTAG
Transcript >Ophun1|7012
ATGTCGAGCACCGCCATGGAAGCCCCCGTCTCATCACCGCTACACTCCCGCACGTCGTCAACGGCCACAACCACG
ACGACAACCTCATCATCATTAACGGCAGCAACAACCGCCCCCGCCACAATGCAGTCCTCGCCTCCGCCCCCGCCC
TCGACCTCGGATCTCCTCCGCGACCTCACCCTCGTCGCCGAAGCCGCAAAGCGCGCCCAGGTAGCCGTCCTCGTC
CGCGACTTTGAGGACTGTGGCCTCGCTTAG
Gene >Ophun1|7012
ATGTCGAGCACCGCCATGGAAGCCCCCGTCTCATCACCGCTACACTCCCGCACGTCGTCAACGGCCACAACCACG
ACGACAACCTCATCATCATTAACGGCAGCAACAACCGCCCCCGCCACAATGCAGTCCTCGCCTCCGCCCCCGCCC
TCGACCTCGGATCTCCTCCGCGACCTCACCCTCGTCGCCGAAGCCGCAAAGCGCGCCCAGGTAGCCGTCCTCGTC
CGCGACTTTGAGGACTGTGGCCTCGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail