Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7010
Gene name
LocationContig_823:4043..6595
Strand-
Gene length (bp)2552
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08624 CRC_subunit Chromatin remodelling complex Rsc7/Swp82 subunit 1.9E-51 114 245

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94522|RSC7_SCHPO Chromatin structure-remodeling complex subunit rsc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsc7 PE=1 SV=1 121 252 7.0E-45
sp|P32832|RSC7_YEAST Chromatin structure-remodeling complex subunit RSC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPL6 PE=1 SV=1 103 265 2.0E-37
sp|O74792|SNF59_SCHPO SWI/SNF global transcription activator complex subunit snf59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf59 PE=1 SV=1 114 229 9.0E-23
sp|P43554|SWP82_YEAST SWI/SNF global transcription activator complex subunit SWP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP82 PE=1 SV=1 112 247 9.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7010
MYSAPLDAATINPAALNSSAPSDAPPRGQKRSHDAPPPAGHDGRPPAAAAAGPPATQPPHTPQSQSTALPSQTTT
AYAAPQAAAPPKPTPTKSTIKALPTVRDHTTDQLNPTGDEYLPREVDEFGEKKVMANGQLCGNRHYRCRTFLVPN
RGDKLFMLATECARVLGYRDSYLLFNKNRSLYKIIANQPEKDDLVQQEILPFSYRSRQIAIVTARSMFRQFGSRV
IENGRRVRDDYWETKARKQGFTEADAAGEKRPGAAKAREAAEAAQNNVLISAPHTEIVYNNTPGPYPGPPQPHLV
SSEFSDSRPRDFGGIIKGGPRQEITGPPYQDQSRPSPLTELHSQAHHAAEFNRSVNQQRDMRSEYIQGIWRRPHE
QPASASLGQQQQQQQPAGGSTDSTAPASRPSSSPHTAASGVASQQQQQQQPQAQQQQAQQPVVTSQSPQMMMTSA
PYSQSMHAPNTLGQAPMRGSSGAMGQGTPGYNYQSGQAMWSQSPQSSHHNYASYTTQAQSSHPSQSPASHMRQPS
SGQMQQPGMPFPAMSGMQYGASQGMYPADQTPRQYLPQQTAPGGPAVSQSWSGQQHSPPPQWWAPPQQPQ*
Coding >Ophun1|7010
ATGTACTCGGCACCGCTCGACGCGGCGACCATCAATCCGGCCGCCCTCAACTCTTCAGCTCCGTCCGACGCGCCC
CCGCGCGGTCAAAAGCGGAGCCACGACGCGCCGCCCCCCGCCGGCCATGACGGGCGGCCGCCCGCCGCCGCTGCT
GCCGGCCCTCCGGCTACCCAGCCGCCGCACACCCCCCAGTCGCAGAGCACCGCTCTGCCCAGTCAAACCACGACG
GCATACGCCGCGCCCCAAGCCGCCGCGCCCCCAAAGCCGACGCCCACCAAGTCGACCATCAAGGCTCTTCCAACC
GTTCGCGATCATACCACCGACCAGCTGAATCCCACCGGCGACGAGTATCTACCCCGCGAGGTGGACGAGTTTGGT
GAGAAAAAGGTCATGGCCAATGGCCAGCTGTGCGGCAACCGTCACTATCGCTGCCGCACCTTTCTCGTCCCCAAC
CGTGGAGACAAGCTGTTCATGCTCGCCACCGAATGCGCCCGCGTCCTCGGCTACCGTGACTCGTACTTGCTCTTC
AACAAGAACAGGTCCCTCTACAAGATCATCGCCAACCAGCCGGAAAAGGACGACCTCGTTCAGCAGGAGATTTTG
CCCTTCTCTTACCGCTCGAGGCAAATCGCCATTGTCACCGCTCGCTCCATGTTCCGCCAGTTTGGGAGCCGCGTC
ATCGAAAACGGTCGCCGAGTCCGCGACGACTACTGGGAGACGAAAGCCCGGAAGCAGGGATTTACCGAGGCTGAT
GCCGCCGGCGAGAAGCGTCCTGGTGCCGCCAAGGCCCGCGAGGCCGCCGAGGCGGCGCAGAACAACGTGCTCATA
AGCGCGCCACATACCGAGATTGTCTACAACAACACCCCGGGCCCCTATCCCGGGCCCCCTCAGCCTCACCTCGTC
TCGTCAGAATTTAGCGACTCCCGTCCCCGAGACTTTGGAGGCATCATCAAGGGCGGCCCCCGCCAGGAGATCACG
GGACCCCCCTACCAGGACCAGAGCCGGCCCTCGCCCCTGACGGAGCTGCACTCGCAGGCCCACCACGCCGCCGAG
TTCAATCGATCCGTCAACCAGCAGCGCGACATGCGGAGCGAGTACATCCAGGGCATCTGGCGTCGGCCCCACGAG
CAACCGGCCTCGGCCAGTCTGGGCCAGCAGCAGCAGCAGCAGCAGCCCGCCGGCGGCTCGACCGACAGCACCGCG
CCCGCTAGCCGGCCTTCGAGCTCTCCTCACACGGCCGCGTCGGGCGTTGCCTCGCAGCAGCAGCAACAGCAACAG
CCGCAGGCGCAGCAGCAGCAGGCGCAGCAGCCCGTGGTGACGTCGCAGAGCCCCCAGATGATGATGACGTCGGCT
CCCTACTCGCAGTCGATGCACGCCCCCAATACGCTCGGCCAGGCGCCCATGAGGGGATCGTCCGGCGCCATGGGC
CAGGGCACTCCGGGCTACAACTACCAGTCGGGTCAGGCCATGTGGTCGCAGAGCCCGCAGTCGTCGCATCACAAC
TACGCCAGCTACACGACGCAGGCGCAGTCGTCGCACCCGTCGCAGTCGCCGGCCTCGCACATGCGCCAGCCGAGC
TCGGGACAGATGCAGCAGCCCGGCATGCCCTTCCCTGCCATGAGCGGCATGCAGTACGGGGCCAGCCAGGGCATG
TACCCGGCCGACCAGACGCCTCGCCAGTATCTTCCGCAGCAGACGGCACCGGGCGGGCCGGCCGTCTCTCAGTCG
TGGTCGGGCCAGCAGCACTCGCCTCCGCCCCAATGGTGGGCTCCCCCTCAGCAGCCGCAATAG
Transcript >Ophun1|7010
ATGTACTCGGCACCGCTCGACGCGGCGACCATCAATCCGGCCGCCCTCAACTCTTCAGCTCCGTCCGACGCGCCC
CCGCGCGGTCAAAAGCGGAGCCACGACGCGCCGCCCCCCGCCGGCCATGACGGGCGGCCGCCCGCCGCCGCTGCT
GCCGGCCCTCCGGCTACCCAGCCGCCGCACACCCCCCAGTCGCAGAGCACCGCTCTGCCCAGTCAAACCACGACG
GCATACGCCGCGCCCCAAGCCGCCGCGCCCCCAAAGCCGACGCCCACCAAGTCGACCATCAAGGCTCTTCCAACC
GTTCGCGATCATACCACCGACCAGCTGAATCCCACCGGCGACGAGTATCTACCCCGCGAGGTGGACGAGTTTGGT
GAGAAAAAGGTCATGGCCAATGGCCAGCTGTGCGGCAACCGTCACTATCGCTGCCGCACCTTTCTCGTCCCCAAC
CGTGGAGACAAGCTGTTCATGCTCGCCACCGAATGCGCCCGCGTCCTCGGCTACCGTGACTCGTACTTGCTCTTC
AACAAGAACAGGTCCCTCTACAAGATCATCGCCAACCAGCCGGAAAAGGACGACCTCGTTCAGCAGGAGATTTTG
CCCTTCTCTTACCGCTCGAGGCAAATCGCCATTGTCACCGCTCGCTCCATGTTCCGCCAGTTTGGGAGCCGCGTC
ATCGAAAACGGTCGCCGAGTCCGCGACGACTACTGGGAGACGAAAGCCCGGAAGCAGGGATTTACCGAGGCTGAT
GCCGCCGGCGAGAAGCGTCCTGGTGCCGCCAAGGCCCGCGAGGCCGCCGAGGCGGCGCAGAACAACGTGCTCATA
AGCGCGCCACATACCGAGATTGTCTACAACAACACCCCGGGCCCCTATCCCGGGCCCCCTCAGCCTCACCTCGTC
TCGTCAGAATTTAGCGACTCCCGTCCCCGAGACTTTGGAGGCATCATCAAGGGCGGCCCCCGCCAGGAGATCACG
GGACCCCCCTACCAGGACCAGAGCCGGCCCTCGCCCCTGACGGAGCTGCACTCGCAGGCCCACCACGCCGCCGAG
TTCAATCGATCCGTCAACCAGCAGCGCGACATGCGGAGCGAGTACATCCAGGGCATCTGGCGTCGGCCCCACGAG
CAACCGGCCTCGGCCAGTCTGGGCCAGCAGCAGCAGCAGCAGCAGCCCGCCGGCGGCTCGACCGACAGCACCGCG
CCCGCTAGCCGGCCTTCGAGCTCTCCTCACACGGCCGCGTCGGGCGTTGCCTCGCAGCAGCAGCAACAGCAACAG
CCGCAGGCGCAGCAGCAGCAGGCGCAGCAGCCCGTGGTGACGTCGCAGAGCCCCCAGATGATGATGACGTCGGCT
CCCTACTCGCAGTCGATGCACGCCCCCAATACGCTCGGCCAGGCGCCCATGAGGGGATCGTCCGGCGCCATGGGC
CAGGGCACTCCGGGCTACAACTACCAGTCGGGTCAGGCCATGTGGTCGCAGAGCCCGCAGTCGTCGCATCACAAC
TACGCCAGCTACACGACGCAGGCGCAGTCGTCGCACCCGTCGCAGTCGCCGGCCTCGCACATGCGCCAGCCGAGC
TCGGGACAGATGCAGCAGCCCGGCATGCCCTTCCCTGCCATGAGCGGCATGCAGTACGGGGCCAGCCAGGGCATG
TACCCGGCCGACCAGACGCCTCGCCAGTATCTTCCGCAGCAGACGGCACCGGGCGGGCCGGCCGTCTCTCAGTCG
TGGTCGGGCCAGCAGCACTCGCCTCCGCCCCAATGGTGGGCTCCCCCTCAGCAGCCGCAATAG
Gene >Ophun1|7010
ATGTACTCGGCACCGCTCGACGCGGCGACCATCAATCCGGCCGCCCTCAACTCTTCAGGTCAGTACTGATGTTTT
GCTCGATAAAGCCTGCTGCTCTCCGCCACACCCCCCGCGTCCCCGCCTCCCTCCCTCCATCCTTATCCCTCCCTC
CACCACTCACTCGACGCACCCTTCCCTTTTGCCGCTCCTGCGCAACATCCCCTCGAGCCCCGCCAGACTGTCGTG
TCGCAATGCTGACCCTCCTCCGGCCTTGACAGCTCCGTCCGACGCGCCCCCGCGCGGTCAAAAGCGGAGCCACGA
CGCGCCGCCCCCCGCCGGCCATGACGGTATGTCGCGTCGTCACTTGCCGACGCCGCCTCGTGCACGCATAGTTGC
TCCTCGACACGAGCGCAGACGCCCGGCCATGTCTGTGGGCAGAGAGGAAGAGACACGGAGAGAGAGAGAGACAGC
ATCACATATCACACTTGCACCTTCACCTTCACTTTTACTTCCACTTGCACATCCACACATGCACAATCCAAGCTG
GAGAGAGCGTGACAGCAGCGAGACGAGAGTGGACAGACGTGAGAGAGAGAGACAGAGCGTGCGCCTGAGAGAGAA
AGAGAGAGCGCCGAGAGAGCTAGCGAGATCCAACACACGGCTGTCTTTGACACGGAGGCTCCGAGATGGACCTCC
CCATCCCAGACCTGCATCGCTAACGCCTCTCCCGCCCCCGCTTTAGGTCCTTCCCCATCGCAACGCAAACGCGCG
CGACCAATGAAGCCGTCCGAGACTGCAGGGCGGCCGCCCGCCGCCGCTGCTGCCGGCCCTCCGGCTACCCAGCCG
CCGCACACCCCCCAGTCGCAGAGCACCGCTCTGCCCAGTCAAACCACGACGGCATACGCCGCGCCCCAAGCCGCC
GCGCCCCCAAAGCCGACGCCCACCAAGTCGACCATCAAGGCTCTTCCAACCGTTCGCGATCATACCACCGACCAG
CTGAATCCCACCGGCGACGAGTATCTACCCCGCGAGGTGGACGAGTTTGGTGAGAAAAAGGTCATGGCCAATGGC
CAGCTGTGCGGCAACCGTCACTATCGCTGCCGCACCTTTCTCGTCCCCAACCGTGGAGACAAGCTGTTCATGCTC
GCCACCGAATGCGCCCGCGTCCTCGGCTACCGTGACTCGTACTTGCTCTTCAACAAGAACAGGTCCCTCTACAAG
ATCATCGCCAACCAGCCGGAAAAGGACGACCTCGTTCAGCAGGAGATTTTGCCCTTCTCTTACCGCTCGAGGCAA
ATCGCCATTGTCACCGCTCGCTCCATGTTCCGCCAGTTTGGGAGCCGCGTCATCGAAAACGGTCGCCGAGTCCGC
GACGACTACTGGGAGACGAAAGCCCGGAAGCAGGGATTTACCGAGGCTGATGCCGCCGGCGAGAAGCGTCCTGGT
GCCGCCAAGGCCCGCGAGGCCGCCGAGGCGGCGCAGAACAACGTGCTCATAAGCGCGCCACATACCGAGATTGTC
TACAACAACACCCCGGGCCCCTATCCCGGGCCCCCTCAGCCTCACCTCGTCTCGTCAGGTAGGATGGCGCCGGCC
CCGCCGTCCCGGTGCCCGCGCTGACAGCCCGCGTAGAATTTAGCGACTCCCGTCCCCGAGACTTTGGAGGCATCA
TCAAGGGCGGCCCCCGCCAGGAGATCACGGGACCCCCCTACCAGGACCAGAGCCGGCCCTCGCCCCTGACGGAGC
TGCACTCGCAGGCCCACCACGCCGCCGAGTTCAATCGATCCGTCAACCAGCAGCGCGACATGCGGAGCGAGTACA
TCCAGGGCATCTGGCGTCGGCCCCACGAGCAACCGGCCTCGGCCAGTCTGGGCCAGCAGCAGCAGCAGCAGCAGC
CCGCCGGCGGCTCGACCGACAGCACCGCGCCCGCTAGCCGGCCTTCGAGCTCTCCTCACACGGCCGCGTCGGGCG
TTGCCTCGCAGCAGCAGCAACAGCAACAGCCGCAGGCGCAGCAGCAGCAGGCGCAGCAGCCCGTGGTGACGTCGC
AGAGCCCCCAGATGATGATGACGTCGGCTCCCTACTCGCAGTCGATGCACGCCCCCAATACGCTCGGCCAGGCGC
CCATGAGGGGTAGGTCCCACGGCCCCCTTGACCGTTCCGGGCCGCCTCTGACGTCGCTCTCCCCCGCAGGATCGT
CCGGCGCCATGGGCCAGGGCACTCCGGGCTACAACTACCAGTCGGGTCAGGCCATGTGGTCGCAGAGCCCGCAGT
CGTCGCATCACAACTACGCCAGCTACACGACGCAGGCGCAGTCGTCGCACCCGTCGCAGTCGCCGGCCTCGCACA
TGCGCCAGCCGAGCTCGGGACAGATGCAGCAGCCCGGCATGCCCTTCCCTGCCATGAGCGGCATGCAGTACGGGG
CCAGCCAGGGCATGTACCCGGCCGACCAGACGCCTCGCCAGTATCTTCCGCAGCAGACGGCACCGGGCGGGCCGG
CCGTCTCTCAGTCGTGGTCGGGCCAGCAGCACTCGCCTCCGCCCCAATGGTGGGCTCCCCCTCAGCAGCCGCAAT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail