Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|701
Gene name
LocationContig_122:33890..35528
Strand+
Gene length (bp)1638
Transcript length (bp)1506
Coding sequence length (bp)1506
Protein length (aa) 502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.0E-27 72 315
PF13506 Glyco_transf_21 Glycosyl transferase family 21 2.8E-07 142 315
PF00535 Glycos_transf_2 Glycosyl transferase family 2 1.9E-06 74 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 49 442 1.0E-09
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 159 453 3.0E-09
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 159 453 3.0E-09
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 150 438 1.0E-08
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 159 438 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 49 442 1.0E-09
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 159 453 3.0E-09
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 159 453 3.0E-09
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 150 438 1.0E-08
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 159 438 2.0E-08
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 159 438 2.0E-08
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 159 438 2.0E-08
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 159 438 2.0E-08
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 159 438 4.0E-08
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 159 438 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 339 361 22
2 376 398 22
3 405 427 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|701
MNDAAVAQLLAGIAGRALVRLINSPRTSPLAWAIVFWVLWIHRYLRLLVHCVSHWTYKSKPIPENPSFTSRSVTV
VIPTIHNVFEELRPSIESILVCDPQELILVTTDPKRAELEKLAASLRVYDGNDKRCNRVRVYSTPIANKRLQVRE
AIPKVETDITVMVDDDVTWPTTMLPWILAPFEDSQMGGVGTCQRAKRDRSGSVASSIWNWLGAAYIERRNFEISA
THNIDGGTSCMSGRTGAYRTSILQDYAFLDGFINEKWRRWILNADDDNFVTRWLVSKQWKTWVQYEPECELETTL
ENNTKFLYQCTRWARSNWRSNWTSLVQERYVWTQQPWCTYALHFATFTSLAFVVDPLLLVSCWLATSEWELYQRQ
WAFWSLFVFIFAFTKTVKLVGLWRRHPVDIIFLPVSIAFGYFHGLIKLYALFTLNMTSWGSRADGDADNDKRLVN
LLPRADVLQNPDGTALVRYNDECPGIDPPRGRDHTKMAMPTAKPAVVEVPS*
Coding >Ophun1|701
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCCGGAATCGCGGGCCGCGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACTTCGCCCCTCGCATGGGCCATTGTGTTTTGGGTCCTCTGGATCCATCGTTACCTGCGTCTGCTCGTTCAT
TGCGTCAGTCACTGGACTTACAAGTCGAAGCCGATCCCGGAGAACCCCAGCTTCACGTCCCGGAGCGTTACCGTG
GTGATTCCAACCATCCACAACGTCTTTGAAGAGCTGCGACCTTCCATCGAGAGCATCCTCGTCTGCGACCCTCAA
GAGCTGATCCTGGTGACGACGGATCCCAAGCGAGCCGAGCTCGAGAAGCTGGCGGCCTCGCTTCGTGTTTACGAT
GGCAACGACAAGCGCTGCAACCGCGTACGCGTCTACAGCACTCCCATTGCCAACAAACGCCTTCAGGTACGAGAG
GCTATTCCCAAAGTCGAGACCGACATCACCGTCATGGTCGACGACGACGTCACCTGGCCCACGACGATGCTCCCC
TGGATTCTGGCTCCCTTCGAGGACAGTCAAATGGGCGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACCGTTCT
GGCTCCGTGGCCTCGAGCATCTGGAACTGGCTCGGCGCGGCTTATATCGAGAGGCGCAACTTTGAGATCTCGGCT
ACGCACAATATCGATGGAGGCACCTCGTGTATGTCGGGCCGGACGGGAGCCTACCGTACAAGCATCCTTCAGGAT
TACGCCTTCCTCGATGGCTTCATCAATGAGAAGTGGCGTCGCTGGATCCTCAATGCCGACGACGACAACTTCGTC
ACCCGCTGGCTTGTCTCCAAGCAGTGGAAGACGTGGGTTCAGTACGAGCCTGAGTGCGAGCTCGAGACTACGCTG
GAGAACAACACCAAGTTCCTGTATCAGTGCACCCGCTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGCCTC
GTGCAGGAGCGTTATGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTGCACTTTGCCACCTTCACCTCGCTG
GCCTTTGTTGTCGATCCTCTGCTGCTCGTCTCGTGCTGGCTGGCTACGTCCGAGTGGGAGCTTTACCAGCGCCAG
TGGGCGTTTTGGTCGCTCTTTGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTGGGCCTTTGGAGGCGT
CATCCGGTCGACATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTCATCAAGCTGTACGCT
CTGTTTACGCTGAACATGACTTCCTGGGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTGGTCAAT
CTTCTTCCGCGCGCCGACGTGCTGCAGAACCCCGACGGTACGGCTCTGGTCCGCTACAATGACGAATGCCCTGGC
ATCGATCCGCCCCGAGGCCGTGATCACACCAAGATGGCCATGCCCACGGCCAAGCCTGCAGTTGTTGAAGTGCCG
TCGTGA
Transcript >Ophun1|701
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCCGGAATCGCGGGCCGCGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACTTCGCCCCTCGCATGGGCCATTGTGTTTTGGGTCCTCTGGATCCATCGTTACCTGCGTCTGCTCGTTCAT
TGCGTCAGTCACTGGACTTACAAGTCGAAGCCGATCCCGGAGAACCCCAGCTTCACGTCCCGGAGCGTTACCGTG
GTGATTCCAACCATCCACAACGTCTTTGAAGAGCTGCGACCTTCCATCGAGAGCATCCTCGTCTGCGACCCTCAA
GAGCTGATCCTGGTGACGACGGATCCCAAGCGAGCCGAGCTCGAGAAGCTGGCGGCCTCGCTTCGTGTTTACGAT
GGCAACGACAAGCGCTGCAACCGCGTACGCGTCTACAGCACTCCCATTGCCAACAAACGCCTTCAGGTACGAGAG
GCTATTCCCAAAGTCGAGACCGACATCACCGTCATGGTCGACGACGACGTCACCTGGCCCACGACGATGCTCCCC
TGGATTCTGGCTCCCTTCGAGGACAGTCAAATGGGCGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACCGTTCT
GGCTCCGTGGCCTCGAGCATCTGGAACTGGCTCGGCGCGGCTTATATCGAGAGGCGCAACTTTGAGATCTCGGCT
ACGCACAATATCGATGGAGGCACCTCGTGTATGTCGGGCCGGACGGGAGCCTACCGTACAAGCATCCTTCAGGAT
TACGCCTTCCTCGATGGCTTCATCAATGAGAAGTGGCGTCGCTGGATCCTCAATGCCGACGACGACAACTTCGTC
ACCCGCTGGCTTGTCTCCAAGCAGTGGAAGACGTGGGTTCAGTACGAGCCTGAGTGCGAGCTCGAGACTACGCTG
GAGAACAACACCAAGTTCCTGTATCAGTGCACCCGCTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGCCTC
GTGCAGGAGCGTTATGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTGCACTTTGCCACCTTCACCTCGCTG
GCCTTTGTTGTCGATCCTCTGCTGCTCGTCTCGTGCTGGCTGGCTACGTCCGAGTGGGAGCTTTACCAGCGCCAG
TGGGCGTTTTGGTCGCTCTTTGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTGGGCCTTTGGAGGCGT
CATCCGGTCGACATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTCATCAAGCTGTACGCT
CTGTTTACGCTGAACATGACTTCCTGGGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTGGTCAAT
CTTCTTCCGCGCGCCGACGTGCTGCAGAACCCCGACGGTACGGCTCTGGTCCGCTACAATGACGAATGCCCTGGC
ATCGATCCGCCCCGAGGCCGTGATCACACCAAGATGGCCATGCCCACGGCCAAGCCTGCAGTTGTTGAAGTGCCG
TCGTGA
Gene >Ophun1|701
ATGAACGACGCTGCCGTGGCCCAGCTGCTGGCCGGAATCGCGGGCCGCGCTCTGGTGCGCCTCATCAACTCTCCG
CGGACTTCGCCCCTCGCATGGGCCATTGTGTTTTGGGTCCTCTGGTAAGAACGAGAGTTGGGAGGGGGAGAGAGA
AAAGGGAGACAAAGAGATCCCGTCAGCTGACTTGCTCTTCACAACAGGATCCATCGTTACCTGCGTCTGCTCGTT
CATTGCGTCAGTCACTGGACTTACAAGTCGAAGCCGATCCCGGAGAACCCCAGCTTCACGTCCCGGAGCGTTACC
GTGGTGATTCCAACCATCCACAACGTCTTTGAAGAGCTGCGACCTTCCATCGAGAGCATCCTCGTCTGCGACCCT
CAAGAGCTGATCCTGGTGACGACGGATCCCAAGCGAGCCGAGCTCGAGAAGCTGGCGGCCTCGCTTCGTGTTTAC
GATGGCAACGACAAGCGCTGCAACCGCGTACGCGTCTACAGCACTCCCATTGCCAACAAACGCCTTCAGGTACGA
GAGGCTATTCCCAAAGTCGAGACCGACATCACCGTCATGGTCGACGACGACGTCACCTGGCCCACGACGATGCTC
CCCTGGATTCTGGCTCCCTTCGAGGACAGTCAAATGGGCGGCGTCGGCACCTGTCAGCGGGCCAAGCGAGACCGT
TCTGGCTCCGTGGCCTCGAGCATCTGGAACTGGCTCGGCGCGGCTTATATCGAGAGGCGCAACTTTGAGATCTCG
GCTACGCACAATATCGATGGAGGCACCTCGTGTATGTCGGGCCGGACGGGAGCCTACCGTACAAGCATCCTTCAG
GATTACGCCTTCCTCGATGGCTTCATCAATGAGAAGTGGCGTCGCTGGATCCTCAATGCCGACGACGACAACTTC
GTCACCCGCTGGCTTGTCTCCAAGCAGTGGAAGACGTGGGTTCAGTACGAGCCTGAGTGCGAGCTCGAGACTACG
CTGGAGAACAACACCAAGTTCCTGTATCAGTGCACCCGCTGGGCGCGCAGCAACTGGCGCAGCAACTGGACCAGC
CTCGTGCAGGAGCGTTATGTCTGGACTCAGCAGCCCTGGTGCACCTACGCCCTGCACTTTGCCACCTTCACCTCG
CTGGCCTTTGTTGTCGATCCTCTGCTGCTCGTCTCGTGCTGGCTGGCTACGTCCGAGTGGGAGCTTTACCAGCGC
CAGTGGGCGTTTTGGTCGCTCTTTGTCTTCATCTTTGCCTTTACCAAGACGGTGAAGCTGGTGGGCCTTTGGAGG
CGTCATCCGGTCGACATCATCTTCCTGCCCGTGTCCATTGCCTTTGGATACTTTCACGGGCTCATCAAGCTGTAC
GCTCTGTTTACGCTGAACATGGTGAGTTCCCATCCATCTAGACATATACACGCATAAACTGACCTCCTCTTTCAG
ACTTCCTGGGGCAGCCGTGCCGACGGAGACGCCGACAACGACAAACGCCTGGTCAATCTTCTTCCGCGCGCCGAC
GTGCTGCAGAACCCCGACGGTACGGCTCTGGTCCGCTACAATGACGAATGCCCTGGCATCGATCCGCCCCGAGGC
CGTGATCACACCAAGATGGCCATGCCCACGGCCAAGCCTGCAGTTGTTGAAGTGCCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail