Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7009
Gene name
LocationContig_823:241..2672
Strand+
Gene length (bp)2431
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 1.5E-08 195 259

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87174|DPB4_SCHPO DNA polymerase epsilon subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb4 PE=1 SV=1 185 286 7.0E-16
sp|Q6CHS6|DPB4_YARLI DNA polymerase epsilon subunit D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB4 PE=3 SV=1 185 265 2.0E-13
sp|Q642A5|DPOE3_RAT DNA polymerase epsilon subunit 3 OS=Rattus norvegicus GN=Pole3 PE=1 SV=1 192 273 4.0E-11
sp|Q5R4W3|DPOE3_PONAB DNA polymerase epsilon subunit 3 OS=Pongo abelii GN=POLE3 PE=2 SV=1 192 273 5.0E-11
sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens GN=POLE3 PE=1 SV=1 192 273 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87174|DPB4_SCHPO DNA polymerase epsilon subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb4 PE=1 SV=1 185 286 7.0E-16
sp|Q6CHS6|DPB4_YARLI DNA polymerase epsilon subunit D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB4 PE=3 SV=1 185 265 2.0E-13
sp|Q642A5|DPOE3_RAT DNA polymerase epsilon subunit 3 OS=Rattus norvegicus GN=Pole3 PE=1 SV=1 192 273 4.0E-11
sp|Q5R4W3|DPOE3_PONAB DNA polymerase epsilon subunit 3 OS=Pongo abelii GN=POLE3 PE=2 SV=1 192 273 5.0E-11
sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens GN=POLE3 PE=1 SV=1 192 273 5.0E-11
sp|Q3SZN5|DPOE3_BOVIN DNA polymerase epsilon subunit 3 OS=Bos taurus GN=POLE3 PE=2 SV=1 192 273 5.0E-11
sp|Q9JKP7|DPOE3_MOUSE DNA polymerase epsilon subunit 3 OS=Mus musculus GN=Pole3 PE=1 SV=1 192 273 5.0E-11
sp|Q75JQ9|DPOE3_DICDI DNA polymerase epsilon subunit 3 OS=Dictyostelium discoideum GN=pole3 PE=3 SV=1 196 276 2.0E-08
sp|Q04603|DPB4_YEAST DNA polymerase epsilon subunit D OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPB4 PE=1 SV=1 182 286 3.0E-08
sp|Q6BIP4|DPB4_DEBHA DNA polymerase epsilon subunit D OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPB4 PE=3 SV=2 186 297 1.0E-07
sp|Q750A4|DPB4_ASHGO DNA polymerase epsilon subunit D OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPB4 PE=3 SV=1 162 294 2.0E-07
sp|P40914|HAP3_KLULA Transcriptional activator HAP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP3 PE=3 SV=1 176 282 3.0E-07
sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2 181 299 5.0E-07
sp|P49592|NC2B_ARATH Protein Dr1 homolog OS=Arabidopsis thaliana GN=DR1 PE=2 SV=1 192 287 7.0E-07
sp|Q6CJD7|DPB4_KLULA DNA polymerase epsilon subunit D OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPB4 PE=3 SV=1 182 278 4.0E-06
sp|O14348|NC2B_SCHPO Negative cofactor 2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncb2 PE=3 SV=1 187 273 6.0E-06
sp|Q32KW0|NFYB_BOVIN Nuclear transcription factor Y subunit beta OS=Bos taurus GN=NFYB PE=2 SV=1 181 285 6.0E-06
sp|P25207|NFYB_CHICK Nuclear transcription factor Y subunit beta OS=Gallus gallus GN=NFYB PE=2 SV=2 181 285 7.0E-06
sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 172 288 7.0E-06
sp|P63140|NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus GN=Nfyb PE=1 SV=1 181 285 8.0E-06
sp|P63139|NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus GN=Nfyb PE=1 SV=1 181 285 8.0E-06
sp|Q6RG77|NFYB_HORSE Nuclear transcription factor Y subunit beta OS=Equus caballus GN=NFYB PE=2 SV=1 181 285 8.0E-06
sp|P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens GN=NFYB PE=1 SV=2 181 285 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7009
MADDNVGTTSTIILATVVPIGSIAVAVAVVFGCCIDIPPTTPVLARAPNARPGLTDQAVQGEDAFVSQARRQPSR
LAKPPPASRPSRHGRSKSSRATIHHEVWYGARAQLPRRSVDHIMSSSAVVLGPSSTMMKPSPSSPVRASLDEQIL
LSQSDIDPDPDPEPEPDDRQGNNSQEKRDRDHSSSKDGVPIEDLSLPKSIITRLAKGVLPPNTQIQANAILAMSK
GATVFISYLASHANEHTASAGKKTISPADVFKALDDTEFSFLREPLEAEFAKFNAVQTEKRSSYRQKVRAAKDAL
PDSSSAHADQSPDEARDPKRPRLDDGPSSVTAAADTDADDADPDVDIDAEPPGATDIIVQAHDHDVDNADDADEE
DDDADDVVDEDDEEDDADEDEVAHHRPADAGGTSGDETQEADEALDGDESD*
Coding >Ophun1|7009
ATGGCCGACGACAACGTGGGCACAACTTCGACCATCATACTCGCCACCGTCGTGCCGATAGGATCCATCGCCGTT
GCTGTGGCCGTCGTGTTTGGATGCTGCATCGACATCCCCCCCACAACCCCCGTCCTCGCGCGCGCCCCCAACGCC
CGCCCGGGACTGACGGACCAGGCGGTGCAGGGCGAGGACGCCTTCGTCAGCCAGGCGAGGAGGCAGCCTTCGCGC
CTGGCCAAGCCGCCGCCCGCGTCGAGGCCTTCGAGACATGGGCGGAGTAAGAGCTCGAGGGCGACGATTCATCAT
GAGGTCTGGTATGGGGCTAGGGCGCAGTTGCCGAGGAGGTCGGTTGATCACATCATGTCTTCTTCGGCGGTGGTG
CTGGGACCTTCTTCGACCATGATGAAACCTTCGCCGTCGTCGCCTGTGCGAGCATCGCTGGATGAGCAGATTCTG
CTCTCGCAATCGGACATTGACCCAGACCCAGACCCCGAACCCGAACCCGACGACCGGCAAGGCAACAACAGCCAA
GAGAAGCGCGACCGCGATCACAGCAGCAGTAAGGATGGCGTGCCAATCGAGGACCTCTCCCTGCCCAAATCCATC
ATCACCAGGCTCGCAAAGGGCGTCTTGCCCCCCAACACCCAGATCCAAGCCAACGCCATCCTCGCCATGAGCAAA
GGCGCCACCGTCTTCATCAGCTACCTCGCCTCCCACGCAAACGAACACACCGCAAGCGCAGGCAAAAAAACAATC
TCCCCCGCCGACGTCTTCAAAGCCCTCGACGACACCGAATTCTCCTTCCTACGCGAACCCCTCGAAGCCGAATTC
GCCAAATTCAACGCCGTCCAAACAGAAAAAAGATCCTCTTACCGACAAAAAGTCCGCGCCGCAAAAGACGCCCTC
CCAGACTCCTCCTCCGCCCACGCAGACCAAAGCCCCGACGAAGCCCGCGACCCCAAACGCCCCCGCCTAGACGAC
GGCCCTTCCTCCGTCACCGCCGCCGCAGACACCGACGCCGATGATGCCGACCCCGACGTCGACATCGACGCCGAA
CCGCCCGGCGCAACCGACATCATCGTCCAAGCCCACGACCATGATGTCGATAATGCCGACGACGCCGACGAGGAA
GACGATGACGCAGACGATGTCGTCGACGAAGATGACGAGGAAGACGACGCAGATGAAGACGAAGTCGCACACCAC
CGCCCCGCCGACGCAGGCGGCACCAGCGGCGACGAAACCCAAGAAGCCGACGAAGCCCTCGACGGAGACGAGAGC
GACTGA
Transcript >Ophun1|7009
ATGGCCGACGACAACGTGGGCACAACTTCGACCATCATACTCGCCACCGTCGTGCCGATAGGATCCATCGCCGTT
GCTGTGGCCGTCGTGTTTGGATGCTGCATCGACATCCCCCCCACAACCCCCGTCCTCGCGCGCGCCCCCAACGCC
CGCCCGGGACTGACGGACCAGGCGGTGCAGGGCGAGGACGCCTTCGTCAGCCAGGCGAGGAGGCAGCCTTCGCGC
CTGGCCAAGCCGCCGCCCGCGTCGAGGCCTTCGAGACATGGGCGGAGTAAGAGCTCGAGGGCGACGATTCATCAT
GAGGTCTGGTATGGGGCTAGGGCGCAGTTGCCGAGGAGGTCGGTTGATCACATCATGTCTTCTTCGGCGGTGGTG
CTGGGACCTTCTTCGACCATGATGAAACCTTCGCCGTCGTCGCCTGTGCGAGCATCGCTGGATGAGCAGATTCTG
CTCTCGCAATCGGACATTGACCCAGACCCAGACCCCGAACCCGAACCCGACGACCGGCAAGGCAACAACAGCCAA
GAGAAGCGCGACCGCGATCACAGCAGCAGTAAGGATGGCGTGCCAATCGAGGACCTCTCCCTGCCCAAATCCATC
ATCACCAGGCTCGCAAAGGGCGTCTTGCCCCCCAACACCCAGATCCAAGCCAACGCCATCCTCGCCATGAGCAAA
GGCGCCACCGTCTTCATCAGCTACCTCGCCTCCCACGCAAACGAACACACCGCAAGCGCAGGCAAAAAAACAATC
TCCCCCGCCGACGTCTTCAAAGCCCTCGACGACACCGAATTCTCCTTCCTACGCGAACCCCTCGAAGCCGAATTC
GCCAAATTCAACGCCGTCCAAACAGAAAAAAGATCCTCTTACCGACAAAAAGTCCGCGCCGCAAAAGACGCCCTC
CCAGACTCCTCCTCCGCCCACGCAGACCAAAGCCCCGACGAAGCCCGCGACCCCAAACGCCCCCGCCTAGACGAC
GGCCCTTCCTCCGTCACCGCCGCCGCAGACACCGACGCCGATGATGCCGACCCCGACGTCGACATCGACGCCGAA
CCGCCCGGCGCAACCGACATCATCGTCCAAGCCCACGACCATGATGTCGATAATGCCGACGACGCCGACGAGGAA
GACGATGACGCAGACGATGTCGTCGACGAAGATGACGAGGAAGACGACGCAGATGAAGACGAAGTCGCACACCAC
CGCCCCGCCGACGCAGGCGGCACCAGCGGCGACGAAACCCAAGAAGCCGACGAAGCCCTCGACGGAGACGAGAGC
GACTGA
Gene >Ophun1|7009
ATGGCCGACGACAACGTGGGCACAACTTCGACCATCATACTCGCCACCGTCGTGCCGATAGGATCCATCGCCGTT
GCTGTGGCCGTCGTGTTTGGATGCTGGTGGCTTCCGCGGCGGAGGAGGAGGCGTCTTCGTCGGTTGCTGTTTCGG
AGGGGGATTACCTCGCCGGTTGATGACGAGGAGATTGCCTCGTGGAAGACGGATCGATCGGAGAAGAAGGCCGGG
GGGGAATCCGGGTTGCAACCTGATGAGGAACCGTTGCCTCCCCCCCCGCCATCCTCCACCGGAGCCCCTTCTTCC
AAGCACCGCCACGCCTCATCCGGAGCATCCTCTCGCAAACCCCCCAGCCTAATCGTCTACCAATCCCGCCTCTCA
GAAGATAACCGAACGATCCCGACATCACCACCGCCGACATCCCCCGGAAGACCCAGCATCGACATCCCCCCCACA
ACCCCCGTCCTCGCGCGCGCCCCCAACGCCCGCCCGGGACTGACGGACCAGGCGGTGCAGGGCGAGGACGCCTTC
GTCAGCCAGGCGAGGAGGCAGCCTTCGCGCCTGGCCAAGCCGCCGCCCGCGTCGAGGCCTTCGAGACATGGGCGG
AGTAAGAGCTCGAGGGCGACGATTCATCATGAGGTCTGGTATGGGGCTAGGGCGCAGTTGCCGAGGAGGTCGGTT
GATCACATCATGTCTTCTTCGGCGGTGGTGCTGGGACCTTCTTCGACCATGATGAAACCTTCGCCGTCGTCGCCT
GTGCGAGCATCGCTGGATGAGCAGATTCTGCTCTCGCAATCGGACATTGGTCGAGCCATCGGATGAGCCATCGTT
GCGGAACACATTTCTTTCCGTCTGTCATCATTTTCTCTTCTTATATTCTCCTCTCACAACATCCAGTCCCAGATC
CCCGACTCTTTCTTCCCTTTGTCAACGATGGATATACCCCGGCGGAAACAGGCCAGAGACGCACCGGGGAGAAAG
CTGGCAGGATCGTTTGTTTGGACATGAGCAGCCTCGACTTGCTGCACCACAAGACTCATGATTTTTTCTTCTTGT
TTCGTTTCTCATCATGTATGATGCCCGCTGTACTGTACGACGGTAGTAACGAAGCTCGCTTCTTCATCGACTCGT
TTGTCTTGTCTTGGGTGGTTGCTTTTGGGTGTGTTGGATGCTGTGTCAAAGGAAGGCGTAGACTCTTCCTGCTAC
GCTCTAGAGCCTAGAGGCTGATGCAAGCGATGTACCAATAGCAACAACCGCTACCCGCCCACCCACTCCACACGT
CAGCCAACGCGCGACGCGCCCTCGTCTCCTCCACCTCCAAAACTCCCCCAAACCACCACCACCACCACCACCACC
ATCTTCACCACCATCGCCATCTACCCACAAATGGCACCACGCAAATCCGACCCCCGAAAGAGCGACGCCTCCGTC
ATCGTCGCCCCTCCCCCCCCCCCCCCCCCCCCCCCCTCGTCAGACCCAGACCCAGACCCCGAACCCGAACCCGAC
GACCGGCAAGGCAACAACAGCCAAGAGAAGCGCGACCGCGATCACAGCAGCAGTAAGGATGGCGTGCCAATCGAG
GTCTGCTCTTCCTCATACATAATCCCTCTCTATTCGTGTGGTTGACACCTTCAGGACCTCTCCCTGCCCAAATCC
ATCATCACCAGGCTCGCAAAGGGCGTCTTGCCCCCCAACACCCAGATCCAAGCCAACGCCATCCTCGCCATGAGC
AAAGGCGCCACCGTCTTCATCAGCTACCTCGCCTCCCAGTACGCTCCCCATCCGCACTTCTCCCCTCCATTCTAA
CAAGCCCAGCGCAAACGAACACACCGCAAGCGCAGGCAAAAAAACAATCTCCCCCGCCGACGTCTTCAAAGCCCT
CGACGACACCGAATTCTCCTTCCTACGCGAACCCCTCGAAGCCGAATTCGCCAGTTCGTCTCTCCATTCATTCTC
AACTCATCAATCGCTAACGCATCCCCCAGAATTCAACGCCGTCCAAACAGAAAAAAGATCCTCTTACCGACAAAA
AGTCCGCGCCGCAAAAGACGCCCTCCCAGACTCCTCCTCCGCCCACGCAGACCAAAGCCCCGACGAAGCCCGCGA
CCCCAAACGCCCCCGCCTAGACGACGGCCCTTCCTCCGTCACCGCCGCCGCAGACACCGACGCCGATGATGCCGA
CCCCGACGTCGACATCGACGCCGAACCGCCCGGCGCAACCGACATCATCGTCCAAGCCCACGACCATGATGTCGA
TAATGCCGACGACGCCGACGAGGAAGACGATGACGCAGACGATGTCGTCGACGAAGATGACGAGGAAGACGACGC
AGATGAAGACGAAGTCGCACACCACCGCCCCGCCGACGCAGGCGGCACCAGCGGCGACGAAACCCAAGAAGCCGA
CGAAGCCCTCGACGGAGACGAGAGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail