Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|7004
Gene name
LocationContig_821:4574..6007
Strand+
Gene length (bp)1433
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01866 Diphthamide_syn Putative diphthamide synthesis protein 7.1E-111 123 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph1 PE=3 SV=1 16 449 0.0E+00
sp|Q4IQ72|DPH1_GIBZE Diphthamide biosynthesis protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH1 PE=3 SV=1 1 449 0.0E+00
sp|Q7SC98|DPH1_NEUCR Diphthamide biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-1 PE=3 SV=1 1 453 0.0E+00
sp|Q5AZJ7|DPH1_EMENI Diphthamide biosynthesis protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph1 PE=3 SV=2 31 449 0.0E+00
sp|Q6BPU5|DPH1_DEBHA Diphthamide biosynthesis protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH1 PE=3 SV=2 30 448 3.0E-169
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph1 PE=3 SV=1 16 449 0.0E+00
sp|Q4IQ72|DPH1_GIBZE Diphthamide biosynthesis protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH1 PE=3 SV=1 1 449 0.0E+00
sp|Q7SC98|DPH1_NEUCR Diphthamide biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-1 PE=3 SV=1 1 453 0.0E+00
sp|Q5AZJ7|DPH1_EMENI Diphthamide biosynthesis protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph1 PE=3 SV=2 31 449 0.0E+00
sp|Q6BPU5|DPH1_DEBHA Diphthamide biosynthesis protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH1 PE=3 SV=2 30 448 3.0E-169
sp|Q59MG1|DPH1_CANAL Diphthamide biosynthesis protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH1 PE=3 SV=2 30 446 4.0E-165
sp|Q75AZ9|DPH1_ASHGO Diphthamide biosynthesis protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH1 PE=3 SV=1 30 453 5.0E-162
sp|O59713|DPH1_SCHPO Diphthamide biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 35 453 2.0E-160
sp|Q6C0S8|DPH1_YARLI Diphthamide biosynthesis protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH1 PE=3 SV=1 31 448 3.0E-159
sp|Q6FTG1|DPH1_CANGA Diphthamide biosynthesis protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH1 PE=3 SV=1 29 448 6.0E-156
sp|P40487|DPH1_YEAST Diphthamide biosynthesis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH1 PE=1 SV=1 26 446 8.0E-156
sp|Q5NCQ5|DPH1_MOUSE Diphthamide biosynthesis protein 1 OS=Mus musculus GN=Dph1 PE=1 SV=1 74 445 2.0E-154
sp|Q6CLC9|DPH1_KLULA Diphthamide biosynthesis protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH1 PE=3 SV=1 30 448 5.0E-152
sp|Q9BZG8|DPH1_HUMAN Diphthamide biosynthesis protein 1 OS=Homo sapiens GN=DPH1 PE=1 SV=2 74 445 1.0E-151
sp|Q3SYT1|DPH1_BOVIN Diphthamide biosynthesis protein 1 OS=Bos taurus GN=DPH1 PE=2 SV=1 74 445 1.0E-150
sp|A7SLX5|DPH1_NEMVE Diphthamide biosynthesis protein 1 OS=Nematostella vectensis GN=dph1 PE=3 SV=1 36 452 3.0E-149
sp|Q6GPQ5|DPH1_XENLA Diphthamide biosynthesis protein 1 OS=Xenopus laevis GN=dph1 PE=2 SV=2 74 445 2.0E-148
sp|Q5ZHX9|DPH1_CHICK Diphthamide biosynthesis protein 1 OS=Gallus gallus GN=DPH1 PE=2 SV=1 78 453 1.0E-147
sp|Q54PW5|DPH1_DICDI Diphthamide biosynthesis protein 1 OS=Dictyostelium discoideum GN=dph1 PE=3 SV=1 78 443 3.0E-146
sp|Q3T7C9|DPH1_LITVA Diphthamide biosynthesis protein 1 OS=Litopenaeus vannamei PE=1 SV=1 54 449 5.0E-140
sp|P49958|DPH1_CAEEL Diphthamide biosynthesis protein 1 OS=Caenorhabditis elegans GN=dph-1 PE=3 SV=2 82 445 2.0E-139
sp|Q4PA25|DPH1_USTMA Diphthamide biosynthesis protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DPH1 PE=3 SV=1 34 449 4.0E-123
sp|Q567W6|DPH1_DANRE Diphthamide biosynthesis protein 1 OS=Danio rerio GN=dph1 PE=2 SV=1 72 389 2.0E-122
sp|P0CN19|DPH1_CRYNB Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH1 PE=3 SV=1 28 445 4.0E-118
sp|P0CN18|DPH1_CRYNJ Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH1 PE=3 SV=1 28 445 4.0E-118
sp|Q8SUZ5|DPH1_ENCCU Diphthamide biosynthesis protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DPH1 PE=3 SV=2 83 445 7.0E-103
sp|Q10206|DPH2_SCHPO Diphthamide biosynthesis protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph2 PE=3 SV=1 102 428 6.0E-26
sp|O58832|DPH2_PYRHO 2-(3-amino-3-carboxypropyl)histidine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dph2 PE=1 SV=1 103 428 2.0E-25
sp|P0CN20|DPH2_CRYNJ Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH2 PE=3 SV=1 102 421 1.0E-23
sp|P0CN21|DPH2_CRYNB Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH2 PE=3 SV=1 102 421 1.0E-23
sp|Q6DE00|DPH2_XENLA Diphthamide biosynthesis protein 2 OS=Xenopus laevis GN=dph2 PE=2 SV=1 102 427 2.0E-22
sp|Q57907|DPH2_METJA 2-(3-amino-3-carboxypropyl)histidine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dph2 PE=3 SV=1 90 444 6.0E-22
sp|A4QN59|DPH2_DANRE Diphthamide biosynthesis protein 2 OS=Danio rerio GN=dph2 PE=2 SV=1 102 438 1.0E-20
sp|Q5ZKI2|DPH2_CHICK Diphthamide biosynthesis protein 2 OS=Gallus gallus GN=DPH2 PE=2 SV=1 102 430 1.0E-20
sp|Q4I5M4|DPH2_GIBZE Diphthamide biosynthesis protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH2 PE=3 SV=1 102 421 8.0E-18
sp|A7SKJ3|DPH2_NEMVE Diphthamide biosynthesis protein 2 OS=Nematostella vectensis GN=dph2 PE=3 SV=1 102 439 2.0E-17
sp|B0G132|DPH2_DICDI Diphthamide biosynthesis protein 2 OS=Dictyostelium discoideum GN=dph2 PE=3 SV=1 102 195 1.0E-15
sp|Q59SJ9|DPH2_CANAL Diphthamide biosynthesis protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH2 PE=3 SV=1 117 440 6.0E-14
sp|Q6FPD9|DPH2_CANGA Diphthamide biosynthesis protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH2 PE=3 SV=1 118 427 6.0E-12
sp|Q568Y2|DPH2_RAT Diphthamide biosynthesis protein 2 OS=Rattus norvegicus GN=Dph2 PE=2 SV=1 102 440 2.0E-11
sp|Q9CR25|DPH2_MOUSE Diphthamide biosynthesis protein 2 OS=Mus musculus GN=Dph2 PE=1 SV=1 102 440 5.0E-11
sp|Q002B5|DPH2_CRIGR Diphthamide biosynthesis protein 2 OS=Cricetulus griseus GN=DPH2 PE=2 SV=1 102 441 3.0E-10
sp|Q7S5C0|DPH2_NEUCR Diphthamide biosynthesis protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-2 PE=3 SV=1 149 421 8.0E-10
sp|Q6CGE7|DPH2_YARLI Diphthamide biosynthesis protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH2 PE=3 SV=1 99 427 1.0E-09
sp|Q08DM2|DPH2_BOVIN Diphthamide biosynthesis protein 2 OS=Bos taurus GN=DPH2 PE=2 SV=1 102 183 8.0E-09
sp|Q09454|DPH2_CAEEL Diphthamide biosynthesis protein 2 OS=Caenorhabditis elegans GN=dph-2 PE=3 SV=2 102 432 1.0E-08
sp|Q5RE82|DPH2_PONAB Diphthamide biosynthesis protein 2 OS=Pongo abelii GN=DPH2 PE=2 SV=1 102 440 2.0E-08
sp|Q9BQC3|DPH2_HUMAN Diphthamide biosynthesis protein 2 OS=Homo sapiens GN=DPH2 PE=1 SV=1 102 183 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0090560 2-(3-amino-3-carboxypropyl)histidine synthase activity Yes
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine Yes
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0006417 regulation of translation No
GO:0019222 regulation of metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006448 regulation of translational elongation No
GO:0016740 transferase activity No
GO:0010608 post-transcriptional regulation of gene expression No
GO:0010468 regulation of gene expression No
GO:0019538 protein metabolic process No
GO:1900247 regulation of cytoplasmic translational elongation No
GO:0018193 peptidyl-amino acid modification No
GO:0009889 regulation of biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0034248 regulation of cellular amide metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0006807 nitrogen compound metabolic process No
GO:0051246 regulation of protein metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0065007 biological regulation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0017182 peptidyl-diphthamide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0018202 peptidyl-histidine modification No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5194
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2077
Ophiocordyceps australis map64 (Brazil) OphauB2|7490
Ophiocordyceps camponoti-floridani Ophcf2|06568
Ophiocordyceps camponoti-rufipedis Ophun1|7004 (this protein)
Ophiocordyceps kimflemingae Ophio5|286
Ophiocordyceps subramaniannii Hirsu2|4022

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|7004
MEDDRAIADLGTAADMEETQRDCACAAPSETLRQPKKRFVGRRAAAQAAQDGPVEANGQSSAIQTSTKARRPPRL
LNRVPREILDDPDLQEAMGLLPTNYNFEIPKTIHRIRSSGARRVALQMPEGLLLFATTLSDVLTRFCPGVETLIM
GDVTYGACCVDDYTARALGCDLLVHYAHSCLVPVDVTRIKTLYVFVDIAIDTAHLLASLERNLASGKTLAVVGTI
QFNATIHGVRPALEAAGFRVVVPQSAPLSKGEILGCTAPRLDGPGADEDGQVDLILYLGDGRFHLESIMIHNPSI
PAYRYDPYSRKLTRETYDHDEMRSLRMDAVRAARSATRWGLILGSLGRQGNPHTMALIEKRLREREIPFVNLLLS
EIFPGKLALMSDVECWVQVACPRLSIDWGYAFPRPLLTPYEALVALGLREGWDANGGVYPMDYYSRDGLGRTRPA
TEE*
Coding >Ophun1|7004
ATGGAAGACGATCGGGCCATCGCCGATCTCGGCACCGCCGCCGACATGGAGGAGACGCAGCGAGATTGCGCCTGC
GCAGCACCCAGTGAAACTCTCAGGCAGCCCAAGAAGCGCTTCGTCGGACGGCGGGCCGCAGCACAGGCAGCCCAG
GACGGGCCCGTCGAAGCCAATGGCCAGAGCAGCGCGATCCAAACCTCCACCAAAGCCCGGCGCCCCCCCCGGCTG
TTGAATCGGGTGCCCCGCGAGATCCTCGATGACCCGGACCTGCAAGAGGCCATGGGCCTTTTGCCAACCAACTAC
AATTTCGAGATCCCCAAGACGATACATCGGATTCGCTCGTCCGGCGCGCGGCGTGTGGCGCTGCAGATGCCCGAG
GGTCTGCTGCTATTTGCGACGACGCTGTCCGACGTGCTGACGCGCTTCTGTCCGGGCGTCGAGACGCTCATCATG
GGTGACGTTACGTACGGCGCGTGCTGCGTCGACGATTATACCGCGCGCGCGCTGGGATGTGACCTGCTGGTGCAC
TACGCTCATAGCTGCCTGGTGCCCGTCGACGTGACGCGCATCAAGACGCTCTACGTCTTCGTCGACATCGCCATC
GATACCGCTCACTTGCTGGCTTCGCTCGAGCGCAACCTGGCGAGCGGGAAGACGCTGGCCGTCGTCGGTACCATC
CAGTTTAACGCCACCATACACGGCGTCCGCCCGGCTCTCGAGGCCGCTGGCTTCCGCGTCGTCGTGCCGCAGTCG
GCGCCTCTCAGCAAGGGTGAGATACTGGGATGCACGGCGCCGCGCCTCGACGGACCTGGCGCAGACGAAGACGGT
CAGGTCGATCTGATTCTTTACCTCGGTGACGGCCGTTTCCACCTCGAGAGCATCATGATCCATAACCCATCCATC
CCGGCCTATCGCTACGACCCATACTCGCGTAAACTGACGCGCGAGACGTACGATCACGACGAGATGCGCTCTCTC
CGGATGGATGCTGTCCGCGCCGCTCGGTCCGCCACACGATGGGGTCTCATCCTCGGCTCCCTTGGCCGGCAAGGC
AACCCGCACACCATGGCTCTCATCGAGAAACGGCTGCGAGAACGCGAGATACCCTTTGTGAACCTGCTTCTAAGT
GAGATTTTCCCCGGGAAGCTGGCGTTGATGAGCGACGTCGAGTGCTGGGTTCAGGTCGCCTGTCCGCGACTGAGC
ATCGACTGGGGCTACGCCTTTCCCCGGCCTTTGCTGACGCCCTACGAAGCCCTCGTGGCGCTGGGGCTGAGGGAA
GGCTGGGATGCGAATGGTGGAGTCTATCCCATGGATTATTATTCAAGGGATGGGTTGGGCAGGACGAGGCCAGCT
ACTGAAGAGTGA
Transcript >Ophun1|7004
ATGGAAGACGATCGGGCCATCGCCGATCTCGGCACCGCCGCCGACATGGAGGAGACGCAGCGAGATTGCGCCTGC
GCAGCACCCAGTGAAACTCTCAGGCAGCCCAAGAAGCGCTTCGTCGGACGGCGGGCCGCAGCACAGGCAGCCCAG
GACGGGCCCGTCGAAGCCAATGGCCAGAGCAGCGCGATCCAAACCTCCACCAAAGCCCGGCGCCCCCCCCGGCTG
TTGAATCGGGTGCCCCGCGAGATCCTCGATGACCCGGACCTGCAAGAGGCCATGGGCCTTTTGCCAACCAACTAC
AATTTCGAGATCCCCAAGACGATACATCGGATTCGCTCGTCCGGCGCGCGGCGTGTGGCGCTGCAGATGCCCGAG
GGTCTGCTGCTATTTGCGACGACGCTGTCCGACGTGCTGACGCGCTTCTGTCCGGGCGTCGAGACGCTCATCATG
GGTGACGTTACGTACGGCGCGTGCTGCGTCGACGATTATACCGCGCGCGCGCTGGGATGTGACCTGCTGGTGCAC
TACGCTCATAGCTGCCTGGTGCCCGTCGACGTGACGCGCATCAAGACGCTCTACGTCTTCGTCGACATCGCCATC
GATACCGCTCACTTGCTGGCTTCGCTCGAGCGCAACCTGGCGAGCGGGAAGACGCTGGCCGTCGTCGGTACCATC
CAGTTTAACGCCACCATACACGGCGTCCGCCCGGCTCTCGAGGCCGCTGGCTTCCGCGTCGTCGTGCCGCAGTCG
GCGCCTCTCAGCAAGGGTGAGATACTGGGATGCACGGCGCCGCGCCTCGACGGACCTGGCGCAGACGAAGACGGT
CAGGTCGATCTGATTCTTTACCTCGGTGACGGCCGTTTCCACCTCGAGAGCATCATGATCCATAACCCATCCATC
CCGGCCTATCGCTACGACCCATACTCGCGTAAACTGACGCGCGAGACGTACGATCACGACGAGATGCGCTCTCTC
CGGATGGATGCTGTCCGCGCCGCTCGGTCCGCCACACGATGGGGTCTCATCCTCGGCTCCCTTGGCCGGCAAGGC
AACCCGCACACCATGGCTCTCATCGAGAAACGGCTGCGAGAACGCGAGATACCCTTTGTGAACCTGCTTCTAAGT
GAGATTTTCCCCGGGAAGCTGGCGTTGATGAGCGACGTCGAGTGCTGGGTTCAGGTCGCCTGTCCGCGACTGAGC
ATCGACTGGGGCTACGCCTTTCCCCGGCCTTTGCTGACGCCCTACGAAGCCCTCGTGGCGCTGGGGCTGAGGGAA
GGCTGGGATGCGAATGGTGGAGTCTATCCCATGGATTATTATTCAAGGGATGGGTTGGGCAGGACGAGGCCAGCT
ACTGAAGAGTGA
Gene >Ophun1|7004
ATGGAAGACGATCGGGCCATCGCCGATCTCGGCACCGCCGCCGACATGGAGGAGACGCAGCGAGATTGCGCCTGC
GCAGCACCCAGTGAAACTCTCAGGCAGCCCAAGAAGCGCTTCGTCGGACGGCGGGCCGCAGCACAGGCAGCCCAG
GACGGGCCCGTCGAAGCCAATGGCCAGAGCAGCGCGATCCAAAGTGAGTCCGATCTCAAATACACATCATCTGCA
GAAATCCCATTCCGAATGAATGGTTAATGTCCGTGTCAGCCTCCACCAAAGCCCGGCGCCCCCCCCGGCTGTTGA
ATCGGGTGCCCCGCGAGATCCTCGATGACCCGGACCTGCAAGAGGCCATGGGCCTTTTGCCAACCAACTACAATT
TCGAGATCCCCAAGACGATACATCGGATTCGCTCGTCCGGCGCGCGGCGTGTGGCGCTGCAGATGCCCGAGGGTC
TGCTGCTATTTGCGACGACGCTGTCCGACGTGCTGACGCGCTTCTGTCCGGGCGTCGAGACGCTCATCATGGGTG
ACGTTACGTACGGCGCGTGCTGCGTCGACGATTATACCGCGCGCGCGCTGGGATGTGACCTGCTGGTGCACTACG
CTCATAGCTGCCTGGTGCCCGTCGACGTGACGCGCATCAAGACGCTCTACGTCTTCGTCGACATCGCCATCGATA
CCGCTCACTTGCTGGCTTCGCTCGAGCGCAACCTGGCGAGCGGGAAGACGCTGGCCGTCGTCGGTACCATCCAGT
TTAACGCCACCATACACGGCGTCCGCCCGGCTCTCGAGGCCGCTGGCTTCCGCGTCGTCGTGCCGCAGTCGGCGC
CTCTCAGCAAGGGTGAGATACTGGGATGCACGGCGCCGCGCCTCGACGGACCTGGCGCAGACGAAGACGGTCAGG
TCGATCTGATTCTTTACCTCGGTGACGGCCGTTTCCACCTCGAGAGCATCATGATCCATAACCCATCCATCCCGG
CCTATCGCTACGACCCATACTCGCGTAAACTGACGCGCGAGACGTACGATCACGACGAGATGCGCTCTCTCCGGA
TGGATGCTGTCCGCGCCGCTCGGTCCGCCACACGATGGGGTCTCATCCTCGGCTCCCTTGGCCGGCAAGGCAACC
CGCACACCATGGCTCTCATCGAGAAACGGCTGCGAGAACGCGAGATACCCTTTGTGAACCTGCTTCTAAGTGAGA
TTTTCCCCGGGAAGCTGGCGTTGATGAGCGACGTCGAGTGCTGGGTTCAGGTCGCCTGTCCGCGACTGAGCATCG
ACTGGGGCTACGCCTTTCCCCGGCCTTTGCTGACGCCCTACGAAGCCCTCGTGGCGCTGGGGCTGAGGGAAGGCT
GGGATGCGAATGGTGGAGTCTATCCCATGGATTATTATTCAAGGGATGGGTTGGGCAGGACGAGGCCAGCTACTG
AAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail