Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6998
Gene name
LocationContig_82:33825..35389
Strand+
Gene length (bp)1564
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.1E-38 163 471
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.2E-08 163 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 57 471 6.0E-133
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 84 471 2.0E-95
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 81 493 2.0E-78
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 78 471 7.0E-75
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 78 471 8.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50582|HSK1_SCHPO Cell cycle serine/threonine-protein kinase hsk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsk1 PE=1 SV=1 57 471 6.0E-133
sp|Q9UQY9|SPO4_SCHPO Cell cycle protein kinase spo4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo4 PE=1 SV=1 84 471 2.0E-95
sp|P06243|CDC7_YEAST Cell division control protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC7 PE=1 SV=2 81 493 2.0E-78
sp|Q8SR83|CDC72_ENCCU Probable cell division control protein 7 homolog 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-2 PE=3 SV=1 78 471 7.0E-75
sp|Q8SR85|CDC71_ENCCU Probable cell division control protein 7 homolog 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC7-1 PE=3 SV=1 78 471 8.0E-75
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 91 279 4.0E-28
sp|Q54DK3|CDC7_DICDI Probable serine/threonine-protein kinase cdc7 OS=Dictyostelium discoideum GN=cdc7 PE=3 SV=1 322 473 1.0E-25
sp|P19454|CSK22_YEAST Casein kinase II subunit alpha' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA2 PE=1 SV=2 178 472 1.0E-22
sp|P40231|CSK2A_SCHPO Casein kinase II subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cka1 PE=2 SV=2 84 473 8.0E-22
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 80 279 2.0E-21
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 79 279 2.0E-20
sp|Q02720|CSK2A_DICDI Casein kinase II subunit alpha OS=Dictyostelium discoideum GN=casK PE=2 SV=1 186 472 2.0E-20
sp|Q54LR6|Y6481_DICDI Probable serine/threonine-protein kinase DDB_G0286481 OS=Dictyostelium discoideum GN=DDB_G0286481 PE=3 SV=1 76 472 2.0E-20
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 97 491 5.0E-19
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 98 481 7.0E-19
sp|P43068|MKC1_CANAX Mitogen-activated protein kinase MKC1 OS=Candida albicans GN=MKC1 PE=3 SV=1 98 481 8.0E-19
sp|P19784|CSK22_HUMAN Casein kinase II subunit alpha' OS=Homo sapiens GN=CSNK2A2 PE=1 SV=1 186 471 1.0E-18
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 121 471 2.0E-18
sp|Q4U925|CSK2A_THEAN Casein kinase II subunit alpha OS=Theileria annulata GN=TA10630 PE=3 SV=2 186 472 2.0E-18
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 97 487 3.0E-18
sp|P20427|CSK22_BOVIN Casein kinase II subunit alpha' OS=Bos taurus GN=CSNK2A2 PE=1 SV=3 186 471 6.0E-18
sp|O54833|CSK22_MOUSE Casein kinase II subunit alpha' OS=Mus musculus GN=Csnk2a2 PE=1 SV=1 186 471 7.0E-18
sp|P28547|CSK2A_THEPA Casein kinase II subunit alpha OS=Theileria parva GN=TP04_0659 PE=3 SV=2 186 472 7.0E-18
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 325 404 9.0E-18
sp|P21869|CSK22_CHICK Casein kinase II subunit alpha' OS=Gallus gallus PE=2 SV=1 186 478 9.0E-18
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 325 404 1.0E-17
sp|Q08466|CSK22_ARATH Casein kinase II subunit alpha-2 OS=Arabidopsis thaliana GN=CKA2 PE=2 SV=3 186 471 1.0E-17
sp|Q08467|CSK21_ARATH Casein kinase II subunit alpha-1 OS=Arabidopsis thaliana GN=CKA1 PE=1 SV=3 186 471 1.0E-17
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 97 481 1.0E-17
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 97 479 3.0E-17
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 232 486 3.0E-17
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 232 486 3.0E-17
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 232 486 4.0E-17
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 232 486 5.0E-17
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 235 489 6.0E-17
sp|P18334|CSK2A_CAEEL Casein kinase II subunit alpha OS=Caenorhabditis elegans GN=kin-3 PE=1 SV=1 211 472 6.0E-17
sp|P28523|CSK2A_MAIZE Casein kinase II subunit alpha OS=Zea mays GN=ACK2 PE=1 SV=1 186 472 7.0E-17
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 165 480 9.0E-17
sp|O64817|CSK23_ARATH Probable casein kinase II subunit alpha OS=Arabidopsis thaliana GN=At2g23080 PE=1 SV=1 186 471 9.0E-17
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 97 472 1.0E-16
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 97 472 1.0E-16
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 97 472 2.0E-16
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 106 481 2.0E-16
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 97 475 2.0E-16
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 158 471 3.0E-16
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 97 474 3.0E-16
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 158 471 3.0E-16
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 97 474 4.0E-16
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 182 488 4.0E-16
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 158 471 6.0E-16
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 180 476 6.0E-16
sp|P08181|CSK2A_DROME Casein kinase II subunit alpha OS=Drosophila melanogaster GN=CkIIalpha PE=1 SV=2 211 471 8.0E-16
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 121 471 9.0E-16
sp|P14681|KSS1_YEAST Mitogen-activated protein kinase KSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSS1 PE=1 SV=1 98 494 9.0E-16
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 165 476 1.0E-15
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 227 471 1.0E-15
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 158 471 1.0E-15
sp|P28020|CSK21_XENLA Casein kinase II subunit alpha OS=Xenopus laevis GN=csnk2a1 PE=2 SV=2 186 471 1.0E-15
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 116 471 1.0E-15
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 97 476 1.0E-15
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 97 480 1.0E-15
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 121 471 2.0E-15
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 232 486 2.0E-15
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 121 471 3.0E-15
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 97 478 3.0E-15
sp|Q8TG13|CSK2A_NEUCR Casein kinase II subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cka PE=2 SV=1 186 471 3.0E-15
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 93 473 4.0E-15
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 97 485 4.0E-15
sp|P68400|CSK21_HUMAN Casein kinase II subunit alpha OS=Homo sapiens GN=CSNK2A1 PE=1 SV=1 186 471 4.0E-15
sp|P68399|CSK21_BOVIN Casein kinase II subunit alpha OS=Bos taurus GN=CSNK2A1 PE=1 SV=1 186 471 4.0E-15
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 121 489 4.0E-15
sp|P19139|CSK21_RAT Casein kinase II subunit alpha OS=Rattus norvegicus GN=Csnk2a1 PE=1 SV=2 186 471 4.0E-15
sp|P21868|CSK21_CHICK Casein kinase II subunit alpha OS=Gallus gallus GN=CSNK2A1 PE=2 SV=1 186 471 5.0E-15
sp|Q8NEV1|CSK23_HUMAN Casein kinase II subunit alpha 3 OS=Homo sapiens GN=CSNK2A3 PE=1 SV=2 186 471 5.0E-15
sp|Q60737|CSK21_MOUSE Casein kinase II subunit alpha OS=Mus musculus GN=Csnk2a1 PE=1 SV=2 186 471 5.0E-15
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 204 485 5.0E-15
sp|P33674|CSK21_RABIT Casein kinase II subunit alpha OS=Oryctolagus cuniculus GN=CSNK2A1 PE=2 SV=1 186 471 6.0E-15
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 97 472 8.0E-15
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 97 472 8.0E-15
sp|P15790|CSK21_YEAST Casein kinase II subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA1 PE=1 SV=1 211 468 8.0E-15
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 118 497 8.0E-15
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 51 485 8.0E-15
sp|Q8SRU0|CSK2A_ENCCU Probable casein kinase II subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CKA1 PE=3 SV=1 94 397 9.0E-15
sp|O64816|CSK2P_ARATH Casein kinase II subunit alpha, chloroplastic OS=Arabidopsis thaliana GN=At2g23070 PE=2 SV=1 186 471 1.0E-14
sp|P24788|CD11B_MOUSE Cyclin-dependent kinase 11B OS=Mus musculus GN=Cdk11b PE=1 SV=2 191 480 2.0E-14
sp|O76484|CSK2A_SPOFR Casein kinase II subunit alpha OS=Spodoptera frugiperda PE=2 SV=1 211 471 2.0E-14
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 97 472 2.0E-14
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 220 485 2.0E-14
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 32 485 2.0E-14
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 165 479 2.0E-14
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 165 497 2.0E-14
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 163 479 2.0E-14
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 227 471 4.0E-14
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 98 479 4.0E-14
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 165 486 4.0E-14
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 141 496 5.0E-14
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 97 475 5.0E-14
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 98 393 6.0E-14
sp|Q9UQ88|CD11A_HUMAN Cyclin-dependent kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=4 191 480 7.0E-14
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 142 482 7.0E-14
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 162 471 8.0E-14
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 141 483 9.0E-14
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 164 473 1.0E-13
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 232 485 1.0E-13
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 97 472 1.0E-13
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 97 472 1.0E-13
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 232 485 2.0E-13
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 97 401 2.0E-13
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 121 471 2.0E-13
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 98 478 2.0E-13
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 232 471 2.0E-13
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 204 485 2.0E-13
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 94 476 3.0E-13
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 56 485 3.0E-13
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 227 485 3.0E-13
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 114 471 3.0E-13
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 114 471 3.0E-13
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 204 485 4.0E-13
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 215 485 4.0E-13
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 165 494 4.0E-13
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 97 472 4.0E-13
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 165 471 4.0E-13
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 225 478 5.0E-13
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 225 478 5.0E-13
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 68 485 6.0E-13
sp|Q12126|CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crk1 PE=1 SV=1 136 490 6.0E-13
sp|A8XSC1|NLK_CAEBR Serine/threonine kinase NLK OS=Caenorhabditis briggsae GN=lit-1 PE=3 SV=2 225 471 6.0E-13
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 97 471 6.0E-13
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 225 478 7.0E-13
sp|P18265|GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus GN=Gsk3a PE=1 SV=1 232 471 7.0E-13
sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens GN=GSK3A PE=1 SV=2 232 471 9.0E-13
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 235 472 9.0E-13
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 98 479 9.0E-13
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 165 471 1.0E-12
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 232 471 1.0E-12
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 94 476 2.0E-12
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 165 485 2.0E-12
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3 9 485 2.0E-12
sp|P0CP66|CPK1_CRYNJ Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPK1 PE=3 SV=1 155 477 2.0E-12
sp|P0CP67|CPK1_CRYNB Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPK1 PE=3 SV=1 155 477 2.0E-12
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 97 472 2.0E-12
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 165 494 2.0E-12
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 221 476 2.0E-12
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 225 478 3.0E-12
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 225 478 3.0E-12
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 225 478 3.0E-12
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 225 478 3.0E-12
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 165 494 3.0E-12
sp|Q4WTN5|BUR1_ASPFU Serine/threonine-protein kinase bur1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bur1 PE=3 SV=1 203 491 3.0E-12
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2 221 485 3.0E-12
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 227 481 4.0E-12
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 227 471 4.0E-12
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 207 495 5.0E-12
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 165 478 6.0E-12
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 97 471 6.0E-12
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 159 481 6.0E-12
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 97 364 7.0E-12
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 94 476 7.0E-12
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 235 471 9.0E-12
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 235 471 9.0E-12
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 97 472 1.0E-11
sp|Q4V8A3|DYRK3_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus GN=Dyrk3 PE=2 SV=1 221 476 1.0E-11
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 207 478 1.0E-11
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 179 374 1.0E-11
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 98 478 1.0E-11
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 98 477 2.0E-11
sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinase OS=Fusarium solani subsp. pisi GN=MAPK PE=2 SV=1 225 482 2.0E-11
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 119 486 2.0E-11
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 98 478 2.0E-11
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 225 478 2.0E-11
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 97 471 2.0E-11
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 120 471 3.0E-11
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 99 472 3.0E-11
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 165 495 3.0E-11
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 159 478 4.0E-11
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 168 471 4.0E-11
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 179 374 4.0E-11
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 97 472 5.0E-11
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 225 485 5.0E-11
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 165 495 5.0E-11
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 155 478 6.0E-11
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 235 471 6.0E-11
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 207 472 8.0E-11
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabidopsis thaliana GN=ASK2 PE=2 SV=1 165 485 8.0E-11
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 97 475 9.0E-11
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 195 374 9.0E-11
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 77 476 9.0E-11
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 168 374 1.0E-10
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 165 495 1.0E-10
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 232 471 1.0E-10
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 165 481 2.0E-10
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 168 374 2.0E-10
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 168 374 2.0E-10
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 165 481 2.0E-10
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 165 471 2.0E-10
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 165 491 2.0E-10
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 97 479 2.0E-10
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 97 479 2.0E-10
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 97 472 2.0E-10
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 165 496 2.0E-10
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 239 483 3.0E-10
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 181 389 3.0E-10
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 232 393 3.0E-10
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 165 481 3.0E-10
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 97 479 4.0E-10
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 97 479 4.0E-10
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 89 374 5.0E-10
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 165 495 5.0E-10
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 97 479 5.0E-10
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 165 379 6.0E-10
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 168 374 7.0E-10
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 165 379 7.0E-10
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 165 496 9.0E-10
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 168 374 9.0E-10
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 165 495 1.0E-09
sp|Q6CRA9|BUR1_KLULA Serine/threonine-protein kinase BUR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BUR1 PE=3 SV=1 59 471 1.0E-09
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 168 374 1.0E-09
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 179 381 1.0E-09
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 165 478 1.0E-09
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 168 374 1.0E-09
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 165 495 1.0E-09
sp|Q8MXI4|PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans GN=pmk-2 PE=3 SV=1 165 481 1.0E-09
sp|Q92398|SPM1_SCHPO Mitogen-activated protein kinase spm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm1 PE=1 SV=1 165 478 2.0E-09
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 92 471 2.0E-09
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 125 380 2.0E-09
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 165 495 3.0E-09
sp|O94324|PPK31_SCHPO Serine/threonine-protein kinase ppk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk31 PE=1 SV=1 142 399 3.0E-09
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 225 497 4.0E-09
sp|Q5Z754|CDKF1_ORYSJ Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. japonica GN=CDKF-1 PE=2 SV=1 335 490 4.0E-09
sp|A2YCH5|CDKF1_ORYSI Cyclin-dependent kinase F-1 OS=Oryza sativa subsp. indica GN=CDKF-1 PE=3 SV=1 335 490 4.0E-09
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 93 374 4.0E-09
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 165 471 6.0E-09
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 181 483 6.0E-09
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 97 479 1.0E-08
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 74 374 1.0E-08
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 211 482 1.0E-08
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 195 375 2.0E-08
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 178 374 2.0E-08
sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 97 486 3.0E-08
sp|Q9Z1B7|MK13_MOUSE Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=1 SV=2 165 471 3.0E-08
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 178 376 4.0E-08
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 236 474 5.0E-08
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 193 374 9.0E-08
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 95 374 1.0E-07
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 147 476 1.0E-07
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 168 376 1.0E-07
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 288 484 1.0E-07
sp|Q59KM8|DBF2_CANAL Cell cycle protein kinase DBF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBF2 PE=2 SV=1 165 380 1.0E-07
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 289 480 1.0E-07
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 168 495 1.0E-07
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 195 376 1.0E-07
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 182 374 2.0E-07
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 168 380 2.0E-07
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 289 479 2.0E-07
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 192 374 2.0E-07
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 182 374 2.0E-07
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 193 374 3.0E-07
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 163 290 3.0E-07
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 95 374 6.0E-07
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 95 374 6.0E-07
sp|Q8SW92|KIN28_ENCCU Probable serine/threonine-protein kinase KIN28 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN28 PE=3 SV=1 103 479 7.0E-07
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 95 374 7.0E-07
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 232 466 1.0E-06
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 165 478 3.0E-06
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 168 284 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6998
MTALTWQGAFEIHEDLATEETVLMADDEADSAATALDQDECGDDEEDDDDHVHDDDDLDDGDDDDDLDMESSDDE
QVETAVQADMDKLQRDFPGFRDKYRLIKRIGEGTFSTVFKAEDMHYGRYDNSWDLQDGPSKWTPPPLKKRRSSSG
APLRASPRRPRPRYVAVKKIYVTSSPARILNELELLHDLRQCPSVCPLITAFRHTDQVVAVLPYFRHGDFRSYFR
DMTTADVAIYLRSLFTALRSVHAHKILHRDIKPTNFLYDPASQHGVLVDFGLAEREGSDCRPCLCHEPREVRRMR
QSASAWVQSAAAGGAAQPGYPKADTRPSRRANRAGTRGFRAPEVLFKCTEQTTAIDIWSVGVVLLTILSKRFPFF
NSADDVEAMIEIATIFGSKRMKAAGLLHGCVFETNIPTVGQQGFSMEKIILWSTCRTDDRPLTPDEKLAVRFLER
CMELDPSRRITAEQALDHEFLRVSQPPSPPVPAGRDDDEDDEVDMLET*
Coding >Ophun1|6998
ATGACGGCTCTCACCTGGCAAGGGGCTTTCGAGATCCACGAGGACTTGGCGACGGAGGAGACGGTGCTGATGGCA
GACGACGAGGCCGACTCGGCTGCTACGGCACTGGATCAAGACGAGTGCGGTGACGACGAAGAGGACGACGATGAC
CATGTCCACGACGATGACGATCTGGACGACGGAGACGATGATGATGACTTGGACATGGAGAGCTCTGACGATGAG
CAGGTCGAGACAGCCGTACAGGCTGACATGGATAAGCTGCAGCGGGACTTTCCCGGCTTCCGCGATAAATATCGC
CTCATCAAGCGCATTGGCGAAGGCACCTTCTCGACCGTCTTCAAGGCCGAGGACATGCACTACGGCCGTTACGAC
AACAGCTGGGATCTGCAAGACGGACCTTCCAAGTGGACGCCTCCGCCGCTCAAGAAACGGCGGTCATCGTCAGGC
GCTCCGCTCCGGGCGTCTCCTCGCCGACCACGGCCGCGATACGTGGCCGTCAAGAAGATTTACGTGACGTCGAGC
CCTGCGCGAATCCTCAACGAGCTCGAGCTGCTGCACGACCTGCGCCAATGCCCGTCCGTGTGTCCGCTCATCACG
GCCTTTCGTCATACGGATCAGGTCGTCGCCGTTCTGCCCTACTTTCGCCATGGGGATTTCCGCTCCTACTTTCGC
GACATGACGACGGCCGACGTGGCCATCTACCTGCGCTCGCTCTTCACTGCCCTGCGAAGCGTCCACGCCCACAAG
ATCCTACACCGCGACATCAAGCCGACCAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTT
GGCCTCGCCGAGCGCGAGGGCTCCGACTGTCGGCCTTGTCTCTGTCACGAGCCGCGTGAGGTTCGTAGGATGCGC
CAGTCGGCCTCGGCCTGGGTTCAGTCCGCTGCTGCCGGGGGAGCGGCTCAACCTGGCTATCCCAAGGCAGACACC
CGACCGTCGCGACGTGCTAATCGTGCTGGCACTCGCGGCTTCCGTGCGCCAGAGGTCTTATTCAAGTGTACGGAG
CAGACGACGGCCATCGATATCTGGTCCGTCGGCGTCGTTCTTCTCACCATCCTGTCAAAGCGCTTCCCCTTCTTC
AACTCGGCCGACGACGTCGAGGCCATGATCGAAATCGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGC
TTGCTGCACGGCTGCGTCTTCGAGACCAACATCCCCACCGTCGGCCAGCAGGGCTTTTCCATGGAGAAGATCATT
CTCTGGAGCACCTGCCGCACCGACGACCGTCCGCTGACCCCGGACGAGAAGCTTGCCGTCCGCTTCCTCGAGCGC
TGCATGGAGCTCGATCCTTCGCGTCGCATCACTGCCGAACAGGCCCTCGATCACGAGTTTCTGCGCGTCTCCCAG
CCGCCGAGTCCGCCTGTGCCAGCCGGCCGTGACGATGATGAAGACGACGAGGTCGATATGCTGGAGACGTAA
Transcript >Ophun1|6998
ATGACGGCTCTCACCTGGCAAGGGGCTTTCGAGATCCACGAGGACTTGGCGACGGAGGAGACGGTGCTGATGGCA
GACGACGAGGCCGACTCGGCTGCTACGGCACTGGATCAAGACGAGTGCGGTGACGACGAAGAGGACGACGATGAC
CATGTCCACGACGATGACGATCTGGACGACGGAGACGATGATGATGACTTGGACATGGAGAGCTCTGACGATGAG
CAGGTCGAGACAGCCGTACAGGCTGACATGGATAAGCTGCAGCGGGACTTTCCCGGCTTCCGCGATAAATATCGC
CTCATCAAGCGCATTGGCGAAGGCACCTTCTCGACCGTCTTCAAGGCCGAGGACATGCACTACGGCCGTTACGAC
AACAGCTGGGATCTGCAAGACGGACCTTCCAAGTGGACGCCTCCGCCGCTCAAGAAACGGCGGTCATCGTCAGGC
GCTCCGCTCCGGGCGTCTCCTCGCCGACCACGGCCGCGATACGTGGCCGTCAAGAAGATTTACGTGACGTCGAGC
CCTGCGCGAATCCTCAACGAGCTCGAGCTGCTGCACGACCTGCGCCAATGCCCGTCCGTGTGTCCGCTCATCACG
GCCTTTCGTCATACGGATCAGGTCGTCGCCGTTCTGCCCTACTTTCGCCATGGGGATTTCCGCTCCTACTTTCGC
GACATGACGACGGCCGACGTGGCCATCTACCTGCGCTCGCTCTTCACTGCCCTGCGAAGCGTCCACGCCCACAAG
ATCCTACACCGCGACATCAAGCCGACCAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTT
GGCCTCGCCGAGCGCGAGGGCTCCGACTGTCGGCCTTGTCTCTGTCACGAGCCGCGTGAGGTTCGTAGGATGCGC
CAGTCGGCCTCGGCCTGGGTTCAGTCCGCTGCTGCCGGGGGAGCGGCTCAACCTGGCTATCCCAAGGCAGACACC
CGACCGTCGCGACGTGCTAATCGTGCTGGCACTCGCGGCTTCCGTGCGCCAGAGGTCTTATTCAAGTGTACGGAG
CAGACGACGGCCATCGATATCTGGTCCGTCGGCGTCGTTCTTCTCACCATCCTGTCAAAGCGCTTCCCCTTCTTC
AACTCGGCCGACGACGTCGAGGCCATGATCGAAATCGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGC
TTGCTGCACGGCTGCGTCTTCGAGACCAACATCCCCACCGTCGGCCAGCAGGGCTTTTCCATGGAGAAGATCATT
CTCTGGAGCACCTGCCGCACCGACGACCGTCCGCTGACCCCGGACGAGAAGCTTGCCGTCCGCTTCCTCGAGCGC
TGCATGGAGCTCGATCCTTCGCGTCGCATCACTGCCGAACAGGCCCTCGATCACGAGTTTCTGCGCGTCTCCCAG
CCGCCGAGTCCGCCTGTGCCAGCCGGCCGTGACGATGATGAAGACGACGAGGTCGATATGCTGGAGACGTAA
Gene >Ophun1|6998
ATGACGGCTCTCACCTGGCAAGGGGCTTTCGAGATCCACGAGGACTTGGCGACGGAGGAGACGGTGCTGATGGCA
GACGACGAGGCCGACTCGGCTGCTACGGCACTGGATCAAGACGAGTGCGGTGACGACGAAGAGGACGACGATGAC
CATGTCCACGACGATGACGATCTGGACGACGGAGACGATGATGATGACTTGGACATGGAGAGCTCTGACGATGAG
CAGGTCGAGACAGCCGTACAGGCTGACATGGATAAGCTGCAGCGGGACTTTCCCGGCTTCCGCGATAAATATCGC
CTCATCAAGCGCATTGGCGAAGGTCTTGTCTTCCTCTTCCCCACCCTTGCACCCTCTCTTGACCCCCTCGCTAAC
TCGTCCACTTTCAGGCACCTTCTCGACCGTCTTCAAGGCCGAGGACATGCACTACGGCCGTTACGACAACAGCTG
GGATCTGCAAGACGGACCTTCCAAGTGGACGCCTCCGCCGCTCAAGAAACGGCGGTCATCGTCAGGCGCTCCGCT
CCGGGCGTCTCCTCGCCGACCACGGCCGCGATACGTGGCCGTCAAGAAGATTTACGTGACGTCGAGCCCTGCGCG
AATCCTCAACGAGCTCGAGCTGCTGCACGACCTGCGCCAATGCCCGTCCGTGTGTCCGCTCATCACGGCCTTTCG
TCATACGGATCAGGTCGTCGCCGTTCTGCCCTACTTTCGCCATGGGGATTTCCGCTCCTACTTTCGCGACATGAC
GACGGCCGACGTGGCCATCTACCTGCGCTCGCTCTTCACTGCCCTGCGAAGCGTCCACGCCCACAAGATCCTACA
CCGCGACATCAAGCCGACCAACTTCCTCTACGACCCGGCCTCGCAGCACGGCGTCCTCGTCGACTTTGGCCTCGC
CGAGCGCGAGGGCTCCGACTGTCGGCCTTGTCTCTGTCACGAGCCGCGTGAGGTTCGTAGGATGCGCCAGTCGGC
CTCGGCCTGGGTTCAGTCCGCTGCTGCCGGGGGAGCGGCTCAACCTGGCTATCCCAAGGCAGACACCCGACCGTC
GCGACGTGCTAATCGTGCTGGCACTCGCGGCTTCCGTGCGCCAGAGGTCTTATTCAAGTGTACGGAGCAGACGAC
GGCCATCGATATCTGGTCCGTCGGCGTCGTTCTTCTCACCATCCTGTCAAAGCGCTTCCCCTTCTTCAACTCGGC
CGACGACGTCGAGGCCATGATCGAAATCGCCACCATCTTCGGCTCCAAGCGGATGAAGGCCGCCGGCTTGCTGCA
CGGCTGCGTCTTCGAGACCAACATCCCCACCGTCGGCCAGCAGGGCTTTTCCATGGAGAAGATCATTCTCTGGAG
CACCTGCCGCACCGACGACCGTCCGCTGACCCCGGACGAGAAGCTTGCCGTCCGCTTCCTCGAGCGCTGCATGGA
GCTCGATCCTTCGCGTCGCATCACTGCCGAACAGGCCCTCGATCACGAGTTTCTGCGCGTCTCCCAGCCGCCGAG
TCCGCCTGTGCCAGCCGGCCGTGACGATGATGAAGACGACGAGGTCGATATGCTGGAGACGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail