Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6995
Gene name
LocationContig_82:25312..25927
Strand+
Gene length (bp)615
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06212 GRIM-19 GRIM-19 protein 1.1E-20 2 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0MQ88|NDUAD_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pongo pygmaeus GN=NDUFA13 PE=2 SV=3 3 113 6.0E-14
sp|Q0MQ90|NDUAD_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pan troglodytes GN=NDUFA13 PE=2 SV=3 3 113 1.0E-13
sp|Q9P0J0|NDUAD_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens GN=NDUFA13 PE=1 SV=3 3 108 1.0E-13
sp|Q0MQ89|NDUAD_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Gorilla gorilla gorilla GN=NDUFA13 PE=2 SV=3 1 113 1.0E-13
sp|Q4R6H1|NDUAD_MACFA NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Macaca fascicularis GN=NDUFA13 PE=2 SV=1 3 108 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0MQ88|NDUAD_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pongo pygmaeus GN=NDUFA13 PE=2 SV=3 3 113 6.0E-14
sp|Q0MQ90|NDUAD_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pan troglodytes GN=NDUFA13 PE=2 SV=3 3 113 1.0E-13
sp|Q9P0J0|NDUAD_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens GN=NDUFA13 PE=1 SV=3 3 108 1.0E-13
sp|Q0MQ89|NDUAD_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Gorilla gorilla gorilla GN=NDUFA13 PE=2 SV=3 1 113 1.0E-13
sp|Q4R6H1|NDUAD_MACFA NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Macaca fascicularis GN=NDUFA13 PE=2 SV=1 3 108 3.0E-13
sp|Q95KV7|NDUAD_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Bos taurus GN=NDUFA13 PE=1 SV=3 3 108 4.0E-13
sp|Q9ERS2|NDUAD_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Mus musculus GN=Ndufa13 PE=1 SV=3 3 108 1.0E-11
sp|Q8RWA7|NDADA_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A OS=Arabidopsis thaliana GN=MEE4 PE=2 SV=1 3 115 4.0E-08
sp|O49313|NDADB_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-B OS=Arabidopsis thaliana GN=At2g33220 PE=2 SV=1 1 115 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6995
MAQDMPPRGGYEPVQYKRNLPIRGFRPGTLLLGFGVVTVYGWYKLFHGMRELNELSRERMWARIHLTALLQAEED
RDQVRRYLADRGREVVAFGRPIDVYHTDRFVRPTFSAVPPREK*
Coding >Ophun1|6995
ATGGCGCAGGACATGCCACCGCGAGGCGGCTACGAGCCCGTTCAGTACAAGAGAAACCTTCCCATCAGGGGCTTC
CGGCCGGGGACGCTGCTGCTGGGCTTTGGCGTCGTGACCGTGTATGGATGGTATAAGCTCTTCCACGGCATGCGC
GAGTTGAACGAGCTCTCGCGGGAGAGAATGTGGGCGCGCATCCACCTCACCGCCCTCCTCCAGGCAGAGGAAGAC
AGAGATCAGGTGCGGCGCTACCTCGCTGATCGGGGCCGTGAGGTGGTGGCCTTTGGGAGACCCATTGACGTCTAT
CACACGGACCGCTTCGTGAGGCCGACCTTTTCTGCGGTGCCGCCGCGGGAGAAGTAG
Transcript >Ophun1|6995
ATGGCGCAGGACATGCCACCGCGAGGCGGCTACGAGCCCGTTCAGTACAAGAGAAACCTTCCCATCAGGGGCTTC
CGGCCGGGGACGCTGCTGCTGGGCTTTGGCGTCGTGACCGTGTATGGATGGTATAAGCTCTTCCACGGCATGCGC
GAGTTGAACGAGCTCTCGCGGGAGAGAATGTGGGCGCGCATCCACCTCACCGCCCTCCTCCAGGCAGAGGAAGAC
AGAGATCAGGTGCGGCGCTACCTCGCTGATCGGGGCCGTGAGGTGGTGGCCTTTGGGAGACCCATTGACGTCTAT
CACACGGACCGCTTCGTGAGGCCGACCTTTTCTGCGGTGCCGCCGCGGGAGAAGTAG
Gene >Ophun1|6995
ATGGCGCAGGACATGCCACCGCGAGGCGGCTACGAGCCCGTTCAGTACAAGGTACGCGGGACCCCCCCCCCCCGC
GAAAGCCCCGGCCGGCGGAAGAAAACGAAGGGCCCGAATTGAAAGATACACGCGGCGGCGGCGGCGGTGGTGTAG
AGAAACCTTCCCATCAGGGGCTTCCGGCCGGGGACGCTGCTGCTGGGCTTTGGCGTCGTGACCGTGTATGGATGG
TATAAGCTCTTCCACGGCATGCGCGAGTTGAAGTAAACTACTACCCCTTCCCCGGGCTCGTGTGGGAAGATGACG
GCTGACTTGGACGTGGGCAGCGAGCTCTCGCGGGAGAGAATGTGGGCGCGCATCCACCTCACCGCCCTCCTCCAG
GCAGAGGAAGACAGAGATCAGGTGCGGCGCTACCTCGCTGATCGGGGCCGTGAGGTGGTGGCCTTTGGGAGACCC
ATTGACGTCTATCACACGGACCGGTGCGTATTGCTTCCCTTCAATCCCCTTTTCCATTCCCCTTTTTTTTTTACC
CTTGTGGGGTCTATGCTCATGCGCGGGTTTTCCTACTTGTCTAGCTTCGTGAGGCCGACCTTTTCTGCGGTGCCG
CCGCGGGAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail