Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6991
Gene name
LocationContig_82:13453..14929
Strand-
Gene length (bp)1476
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.5E-22 28 167
PF08031 BBE Berberine and berberine like 6.7E-10 410 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 468 2.0E-60
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 10 300 1.0E-34
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 35 206 5.0E-13
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 13 193 1.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 30 447 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 7 468 2.0E-60
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 10 300 1.0E-34
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 35 206 5.0E-13
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 13 193 1.0E-10
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 30 447 3.0E-09
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 30 193 2.0E-08
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 13 193 1.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 34 210 5.0E-07
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 30 199 5.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 24 447 1.0E-06
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 38 221 2.0E-06
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 28 209 4.0E-06
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 30 197 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6991
MSPLFVNNSCDAFQPRDTPCELASFVRYTVAARDAKDVAATVKFAKRHNVRLVIKNTGHDYLGRSTGAGALSIWT
QSMKEIRVRDWADKGYVGKALRLGAGVLGYEAVAAARDAGLVVVAGSCPSVGLAGGYTQGGGHSSLSNAFGLAAD
NTLSFDVVTPSGRLVTASPWNRHRDLYWALSGGGGGNFGVVISVTVKAHPDARVAGAQLVIHIPPGMKSVDAAPL
ALPTNLPAIVDDGFSFLYTVNKTQLVGIVTGYNKTQASLRRSLKPHEAAVKKEGFIWSASYTEFSHFSDHYDHYM
TMSVPEALGVVGNTAGGHFFTRSSLANLTSVSKEAIAMGATVFGIALDVSRFGSHGANAVSPHWRQAILSIGPFF
PLPETVTQEELEANRDKMTNEVMPLFEAAAPGAGAYMNEADFQDPNFQTNFFGTNYPALLSIKNKYDPHGFFYAT
AAVGSEKWQVGSDGRLCRRRSSPQVETKLASGPAPDMHDSL*
Coding >Ophun1|6991
ATGTCCCCGCTGTTTGTCAACAACAGCTGTGATGCCTTCCAGCCGAGGGACACGCCCTGCGAGCTGGCCAGCTTT
GTTCGCTACACCGTGGCCGCCAGAGATGCCAAAGACGTGGCTGCGACGGTCAAATTCGCCAAACGGCACAATGTC
CGGCTCGTCATCAAGAACACCGGCCACGACTACCTTGGTCGCTCCACTGGGGCCGGCGCCCTCTCGATCTGGACC
CAGAGCATGAAAGAGATCCGGGTCCGGGACTGGGCCGACAAGGGCTACGTCGGAAAGGCTCTCCGCCTTGGCGCG
GGTGTCCTGGGCTACGAAGCCGTAGCGGCTGCCCGCGATGCCGGTCTGGTGGTTGTGGCGGGATCATGCCCGTCG
GTCGGCCTAGCAGGGGGCTATACCCAGGGCGGCGGGCATTCGTCTCTCAGCAACGCCTTCGGCTTGGCCGCTGAC
AACACGCTCAGCTTCGACGTGGTGACGCCGTCGGGGCGGCTCGTGACGGCCTCGCCGTGGAATCGCCATCGCGAC
CTGTACTGGGCTTTGAGCGGCGGAGGAGGAGGCAACTTTGGCGTCGTCATCTCCGTTACTGTCAAGGCCCATCCG
GACGCCCGCGTGGCCGGTGCGCAATTGGTGATACACATTCCGCCGGGCATGAAGAGTGTAGACGCTGCGCCTCTG
GCCCTTCCTACCAATCTTCCCGCCATAGTCGACGACGGTTTCAGCTTCCTTTACACCGTCAACAAGACCCAGCTC
GTGGGAATCGTCACGGGCTACAACAAGACACAAGCCAGCCTCCGGCGCTCGCTGAAGCCACACGAGGCTGCCGTC
AAGAAAGAGGGCTTCATCTGGTCGGCTAGCTACACCGAATTTTCTCATTTCTCTGACCACTACGACCACTACATG
ACCATGTCTGTTCCGGAAGCTCTAGGCGTCGTGGGCAACACCGCAGGCGGCCATTTCTTTACCCGGTCTTCCCTC
GCTAACCTCACCTCCGTCTCCAAGGAAGCCATCGCAATGGGCGCAACCGTCTTCGGCATCGCCCTCGACGTGTCG
AGATTCGGCTCCCACGGGGCCAACGCCGTATCGCCACATTGGCGGCAGGCCATCCTCAGCATCGGTCCCTTCTTC
CCGCTGCCCGAAACCGTGACGCAAGAGGAACTCGAGGCGAACAGAGACAAGATGACCAACGAGGTGATGCCGCTT
TTCGAGGCCGCAGCTCCCGGCGCCGGCGCCTACATGAACGAGGCCGACTTTCAGGACCCAAACTTCCAGACGAAT
TTCTTCGGCACCAATTATCCCGCCCTGCTGAGCATCAAGAACAAGTATGATCCTCATGGCTTCTTTTACGCCACG
GCGGCCGTCGGCAGCGAGAAGTGGCAAGTCGGCAGCGATGGCCGTTTATGTCGTCGCCGCTCTTCTCCTCAAGTG
GAAACGAAGCTTGCATCTGGCCCGGCCCCGGACATGCACGATTCGCTTTGA
Transcript >Ophun1|6991
ATGTCCCCGCTGTTTGTCAACAACAGCTGTGATGCCTTCCAGCCGAGGGACACGCCCTGCGAGCTGGCCAGCTTT
GTTCGCTACACCGTGGCCGCCAGAGATGCCAAAGACGTGGCTGCGACGGTCAAATTCGCCAAACGGCACAATGTC
CGGCTCGTCATCAAGAACACCGGCCACGACTACCTTGGTCGCTCCACTGGGGCCGGCGCCCTCTCGATCTGGACC
CAGAGCATGAAAGAGATCCGGGTCCGGGACTGGGCCGACAAGGGCTACGTCGGAAAGGCTCTCCGCCTTGGCGCG
GGTGTCCTGGGCTACGAAGCCGTAGCGGCTGCCCGCGATGCCGGTCTGGTGGTTGTGGCGGGATCATGCCCGTCG
GTCGGCCTAGCAGGGGGCTATACCCAGGGCGGCGGGCATTCGTCTCTCAGCAACGCCTTCGGCTTGGCCGCTGAC
AACACGCTCAGCTTCGACGTGGTGACGCCGTCGGGGCGGCTCGTGACGGCCTCGCCGTGGAATCGCCATCGCGAC
CTGTACTGGGCTTTGAGCGGCGGAGGAGGAGGCAACTTTGGCGTCGTCATCTCCGTTACTGTCAAGGCCCATCCG
GACGCCCGCGTGGCCGGTGCGCAATTGGTGATACACATTCCGCCGGGCATGAAGAGTGTAGACGCTGCGCCTCTG
GCCCTTCCTACCAATCTTCCCGCCATAGTCGACGACGGTTTCAGCTTCCTTTACACCGTCAACAAGACCCAGCTC
GTGGGAATCGTCACGGGCTACAACAAGACACAAGCCAGCCTCCGGCGCTCGCTGAAGCCACACGAGGCTGCCGTC
AAGAAAGAGGGCTTCATCTGGTCGGCTAGCTACACCGAATTTTCTCATTTCTCTGACCACTACGACCACTACATG
ACCATGTCTGTTCCGGAAGCTCTAGGCGTCGTGGGCAACACCGCAGGCGGCCATTTCTTTACCCGGTCTTCCCTC
GCTAACCTCACCTCCGTCTCCAAGGAAGCCATCGCAATGGGCGCAACCGTCTTCGGCATCGCCCTCGACGTGTCG
AGATTCGGCTCCCACGGGGCCAACGCCGTATCGCCACATTGGCGGCAGGCCATCCTCAGCATCGGTCCCTTCTTC
CCGCTGCCCGAAACCGTGACGCAAGAGGAACTCGAGGCGAACAGAGACAAGATGACCAACGAGGTGATGCCGCTT
TTCGAGGCCGCAGCTCCCGGCGCCGGCGCCTACATGAACGAGGCCGACTTTCAGGACCCAAACTTCCAGACGAAT
TTCTTCGGCACCAATTATCCCGCCCTGCTGAGCATCAAGAACAAGTATGATCCTCATGGCTTCTTTTACGCCACG
GCGGCCGTCGGCAGCGAGAAGTGGCAAGTCGGCAGCGATGGCCGTTTATGTCGTCGCCGCTCTTCTCCTCAAGTG
GAAACGAAGCTTGCATCTGGCCCGGCCCCGGACATGCACGATTCGCTTTGA
Gene >Ophun1|6991
ATGTCCCCGCTGTTTGTCAACAACAGCTGTGATGCCTTCCAGCCGAGGGACACGCCCTGCGAGCTGGCCAGCTTT
GTTCGCTACACCGTGGCCGCCAGAGATGCCAAAGACGTGGCTGCGACGGTCAAATTCGCCAAACGGCACAATGTC
CGGCTCGTCATCAAGAACACCGGCCACGACTACCTTGGTCGCTCCACTGGGGCCGGCGCCCTCTCGATCTGGACC
CAGAGCATGAAAGAGATCCGGGTCCGGGACTGGGCCGACAAGGGCTACGTCGGAAAGGCTCTCCGCCTTGGCGCG
GGTGTCCTGGGCTACGAAGCCGTAGCGGCTGCCCGCGATGCCGGTCTGGTGGTTGTGGCGGGATCATGCCCGTCG
GTCGGCCTAGCAGGGGGCTATACCCAGGGCGGCGGGCATTCGTCTCTCAGCAACGCCTTCGGCTTGGCCGCTGAC
AACACGCTCAGCTTCGACGTGGTGACGCCGTCGGGGCGGCTCGTGACGGCCTCGCCGTGGAATCGCCATCGCGAC
CTGTACTGGGCTTTGAGCGGCGGAGGAGGAGGCAACTTTGGCGTCGTCATCTCCGTTACTGTCAAGGCCCATCCG
GACGCCCGCGTGGCCGGTGCGCAATTGGTGATACACATTCCGCCGGGCATGAAGAGTGTAGACGCTGCGCCTCTG
GCCCTTCCTACCAATCTTCCCGCCATAGTCGACGACGGTTTCAGCTTCCTTTACACCGTCAACAAGACCCAGCTC
GTGGGAATCGTCACGGGCTACAACAAGACACAAGCCAGCCTCCGGCGCTCGCTGAAGCCACACGAGGCTGCCGTC
AAGAAAGAGGGCTTCATCTGGTCGGCTAGCTACACCGAATTTTCTCATTTCTCTGACCACTACGACCACTACATG
ACCATGTCTGTTCCGGAAGCTCTAGGCGTCGTGGGCAACACCGCAGGCGGCCATTTCTTTACCCGGTCTTCCCTC
GCTAACCTCACCTCCGTCTCCAAGGAAGCCATCGCAATGGGCGCAACCGTCTTCGGCATCGCCCTCGACGTGTCG
AGATTCGGCTCCCACGGGGCCAACGCCGTATCGCCACATTGGCGGCAGGCCATCCTCAGCATCGGTCCCTTCTTC
CCGCTGCCCGAAACCGTGACGCAAGAGGAACTCGAGGCGAACAGAGACAAGATGACCAACGAGGTGATGCCGCTT
TTCGAGGCCGCAGCTCCCGGCGCCGGCGCCTACATGAACGAGGCCGACTTTCAGGACCCAAACTTCCAGACGAAT
TTCTTCGGCACCAATTATCCCGCCCTGCTGAGCATCAAGAACAAGTATGATCCTCATGGCTTCTTTTACGCCACG
GCGGCCGTCGGCAGCGAGAAGTGGCAAGTCGGCAGCGATGGCCGTTTATGTCGTCGCCGCTCTTCTCCTCAAGTG
GAAACGAAGCTTGCATCTGGCCCGGCCCCGGACATGCACGATTCGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail