Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6983
Gene name
LocationContig_818:3350..6412
Strand+
Gene length (bp)3062
Transcript length (bp)3006
Coding sequence length (bp)3006
Protein length (aa) 1002

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 2.9E-44 298 519
PF04675 DNA_ligase_A_N DNA ligase N terminus 1.0E-41 44 246
PF09414 RNA_ligase RNA ligase 3.4E-22 314 519
PF04679 DNA_ligase_A_C ATP dependent DNA ligase C terminal region 6.8E-13 544 666
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 1.2E-04 732 810

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB49|DNLI4_NEUCR DNA ligase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-53 PE=3 SV=2 5 1001 0.0E+00
sp|Q1DKE7|DNLI4_COCIM DNA ligase 4 OS=Coccidioides immitis (strain RS) GN=LIG4 PE=3 SV=1 22 1000 0.0E+00
sp|Q4WVG8|DNLI4_ASPFU DNA ligase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lig4 PE=3 SV=1 21 999 0.0E+00
sp|Q2U6A1|DNLI4_ASPOR DNA ligase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lig4 PE=3 SV=1 27 999 0.0E+00
sp|Q5BH83|DNLI4_EMENI DNA ligase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lig4 PE=3 SV=1 20 999 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB49|DNLI4_NEUCR DNA ligase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-53 PE=3 SV=2 5 1001 0.0E+00
sp|Q1DKE7|DNLI4_COCIM DNA ligase 4 OS=Coccidioides immitis (strain RS) GN=LIG4 PE=3 SV=1 22 1000 0.0E+00
sp|Q4WVG8|DNLI4_ASPFU DNA ligase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lig4 PE=3 SV=1 21 999 0.0E+00
sp|Q2U6A1|DNLI4_ASPOR DNA ligase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lig4 PE=3 SV=1 27 999 0.0E+00
sp|Q5BH83|DNLI4_EMENI DNA ligase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lig4 PE=3 SV=1 20 999 0.0E+00
sp|Q0UCI9|DNLI4_PHANO DNA ligase 4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIG4 PE=3 SV=1 1 999 0.0E+00
sp|Q6C8A3|DNLI4_YARLI DNA ligase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIG4 PE=3 SV=1 36 999 0.0E+00
sp|O74833|DNLI4_SCHPO DNA ligase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lig4 PE=3 SV=3 34 988 3.0E-176
sp|A8N936|DNLI4_COPC7 DNA ligase 4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=LIG4 PE=3 SV=2 32 891 4.0E-137
sp|Q7Z7W5|DNLI4_COPCI DNA ligase 4 OS=Coprinopsis cinerea GN=LIG4 PE=2 SV=1 32 891 5.0E-137
sp|Q5R6L3|DNLI4_PONAB DNA ligase 4 OS=Pongo abelii GN=DNL4 PE=2 SV=1 97 1001 1.0E-124
sp|Q8BTF7|DNLI4_MOUSE DNA ligase 4 OS=Mus musculus GN=Lig4 PE=2 SV=2 94 1001 4.0E-124
sp|P49917|DNLI4_HUMAN DNA ligase 4 OS=Homo sapiens GN=LIG4 PE=1 SV=2 97 1001 3.0E-123
sp|Q90YB1|DNLI4_CHICK DNA ligase 4 OS=Gallus gallus GN=LIG4 PE=2 SV=2 33 1001 5.0E-123
sp|P52496|DNLI4_CANAL DNA ligase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIG4 PE=2 SV=3 80 851 3.0E-114
sp|Q75CA4|DNLI4_ASHGO DNA ligase 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LIG4 PE=3 SV=1 78 1000 5.0E-111
sp|Q6CSH0|DNLI4_KLULA DNA ligase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LIG4 PE=3 SV=1 85 813 1.0E-108
sp|P0CN08|DNLI4_CRYNJ DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LIG4 PE=3 SV=1 81 806 1.0E-108
sp|P0CN09|DNLI4_CRYNB DNA ligase 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LIG4 PE=3 SV=1 81 806 1.0E-108
sp|Q08387|DNLI4_YEAST DNA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNL4 PE=1 SV=1 36 1001 5.0E-102
sp|Q54CR9|DNLI4_DICDI DNA ligase 4 OS=Dictyostelium discoideum GN=lig4 PE=3 SV=1 99 861 1.0E-101
sp|Q6FVD8|DNLI4_CANGA DNA ligase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LIG4 PE=3 SV=1 85 999 6.0E-101
sp|Q9LL84|DNLI4_ARATH DNA ligase 4 OS=Arabidopsis thaliana GN=LIG4 PE=1 SV=1 100 1001 1.0E-84
sp|Q7X7E9|DNLI4_ORYSJ Putative DNA ligase 4 OS=Oryza sativa subsp. japonica GN=LIG4 PE=2 SV=2 99 702 1.0E-63
sp|P12000|DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc17 PE=3 SV=1 184 691 5.0E-45
sp|P49916|DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens GN=LIG3 PE=1 SV=2 33 733 1.0E-40
sp|P04819|DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC9 PE=1 SV=2 184 689 2.0E-40
sp|P97386|DNLI3_MOUSE DNA ligase 3 OS=Mus musculus GN=Lig3 PE=1 SV=2 100 719 1.0E-38
sp|Q67480|DNLI_FOWPN DNA ligase OS=Fowlpox virus (strain NVSL) GN=LIG PE=3 SV=2 77 680 1.0E-36
sp|Q42572|DNLI1_ARATH DNA ligase 1 OS=Arabidopsis thaliana GN=LIG1 PE=2 SV=2 220 682 1.0E-35
sp|Q9W1H4|DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster GN=DNA-ligI PE=1 SV=2 120 694 1.0E-35
sp|Q976G4|DNLI_SULTO DNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=lig PE=3 SV=1 120 689 1.0E-34
sp|O93723|DNLI_PYRAE DNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=lig PE=3 SV=2 173 683 2.0E-34
sp|A1RTK4|DNLI_PYRIL DNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=lig PE=3 SV=1 173 683 3.0E-34
sp|B1YA52|DNLI_PYRNV DNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=lig PE=3 SV=1 173 683 6.0E-34
sp|Q8TSR7|DNLI1_METAC DNA ligase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig1 PE=3 SV=1 161 684 7.0E-34
sp|A3MS62|DNLI_PYRCJ DNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=lig PE=3 SV=1 184 683 4.0E-33
sp|Q27474|DNLI1_CAEEL DNA ligase 1 OS=Caenorhabditis elegans GN=lig-1 PE=3 SV=2 159 691 1.0E-32
sp|A9A3K1|DNLI_NITMS DNA ligase OS=Nitrosopumilus maritimus (strain SCM1) GN=lig PE=3 SV=1 159 693 1.0E-32
sp|A4WH24|DNLI_PYRAR DNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=lig PE=3 SV=1 173 683 2.0E-32
sp|Q4JAM1|DNLI_SULAC DNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=lig PE=3 SV=1 179 682 4.0E-32
sp|O57250|DNLI_VACCA DNA ligase OS=Vaccinia virus (strain Ankara) GN=LIG PE=3 SV=1 74 682 5.0E-32
sp|P16272|DNLI_VACCW DNA ligase OS=Vaccinia virus (strain Western Reserve) GN=LIG PE=1 SV=1 74 682 1.0E-31
sp|P20492|DNLI_VACCC DNA ligase OS=Vaccinia virus (strain Copenhagen) GN=LIG PE=1 SV=1 74 682 1.0E-31
sp|P37913|DNLI1_MOUSE DNA ligase 1 OS=Mus musculus GN=Lig1 PE=1 SV=2 193 683 4.0E-31
sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens GN=LIG1 PE=1 SV=1 312 686 6.0E-31
sp|P33798|DNLI_VAR67 DNA ligase OS=Variola virus (isolate Human/India/Ind3/1967) GN=LIG PE=3 SV=1 74 682 7.0E-31
sp|A4YD25|DNLI_METS5 DNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=lig PE=3 SV=1 171 691 2.0E-30
sp|A8MDU6|DNLI_CALMQ DNA ligase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=lig PE=3 SV=1 165 680 7.0E-30
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum GN=lig1 PE=3 SV=1 220 690 9.0E-30
sp|O67398|DNLI_AQUAE Probable DNA ligase OS=Aquifex aeolicus (strain VF5) GN=lig PE=3 SV=2 125 680 1.0E-29
sp|Q9JHY8|DNLI1_RAT DNA ligase 1 OS=Rattus norvegicus GN=Lig1 PE=1 SV=1 312 683 8.0E-29
sp|Q9HJ26|DNLI_THEAC DNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lig PE=3 SV=1 161 683 1.0E-28
sp|Q980T8|DNLI_SULSO DNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=lig PE=1 SV=1 184 683 2.0E-28
sp|Q979A1|DNLI_THEVO DNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=lig PE=3 SV=1 120 683 9.0E-28
sp|P51892|DNLI1_XENLA DNA ligase 1 OS=Xenopus laevis GN=lig1 PE=2 SV=1 305 686 2.0E-27
sp|Q8PVR7|DNLI1_METMA DNA ligase 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig1 PE=3 SV=1 161 681 8.0E-27
sp|C0QSL7|DNLI_PERMH Probable DNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=lig PE=3 SV=1 162 677 9.0E-27
sp|C3NF77|DNLI_SULIN DNA ligase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=lig PE=3 SV=1 120 683 4.0E-26
sp|C3MYD2|DNLI_SULIM DNA ligase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=lig PE=3 SV=1 120 683 4.0E-26
sp|C3MJ14|DNLI_SULIL DNA ligase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=lig PE=3 SV=1 120 683 4.0E-26
sp|C4KIZ2|DNLI_SULIK DNA ligase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=lig PE=3 SV=1 120 683 4.0E-26
sp|C3MZR1|DNLI_SULIA DNA ligase OS=Sulfolobus islandicus (strain M.16.27) GN=lig PE=3 SV=1 120 683 4.0E-26
sp|B8DZX8|DNLI_DICTD Probable DNA ligase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=lig PE=3 SV=1 183 688 5.0E-26
sp|C3N834|DNLI_SULIY DNA ligase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=lig PE=3 SV=1 120 683 5.0E-26
sp|Q9P9K9|DNLI_SULSH DNA ligase OS=Sulfolobus shibatae GN=lig PE=1 SV=1 184 696 6.0E-26
sp|Q54QM4|DNLI3_DICDI DNA ligase 3 OS=Dictyostelium discoideum GN=lig3 PE=3 SV=1 162 684 1.0E-25
sp|B5YD88|DNLI_DICT6 Probable DNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=lig PE=3 SV=1 183 688 1.0E-25
sp|Q9YD18|DNLI_AERPE DNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=lig PE=1 SV=2 120 695 3.0E-25
sp|Q46C04|DNLI1_METBF DNA ligase 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig1 PE=3 SV=1 170 682 3.0E-25
sp|A1RY72|DNLI2_THEPD DNA ligase 2 OS=Thermofilum pendens (strain Hrk 5) GN=lig2 PE=3 SV=1 183 680 5.0E-25
sp|B1L3V2|DNLI2_KORCO DNA ligase 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig2 PE=3 SV=1 183 683 5.0E-25
sp|Q46BA3|DNLI2_METBF DNA ligase 2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=lig2 PE=3 SV=1 183 675 6.0E-25
sp|Q9C1W9|DNLI3_SCHPO DNA ligase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adl1 PE=3 SV=1 184 673 9.0E-25
sp|Q9YMV2|DNLI_NPVLD DNA ligase OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=LIG PE=1 SV=1 184 693 3.0E-24
sp|P0CL74|DNLI_PYRAY DNA ligase OS=Pyrococcus abyssi GN=lig PE=3 SV=1 184 682 4.0E-24
sp|P0CL75|DNLI_PYRAB DNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=lig PE=3 SV=1 161 682 5.0E-24
sp|Q8TMT1|DNLI2_METAC DNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lig2 PE=3 SV=1 183 675 5.0E-24
sp|Q02093|DNLI_ACIAM DNA ligase OS=Acidianus ambivalens GN=lig PE=3 SV=1 184 691 6.0E-24
sp|P56709|DNLI_PYRFU DNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=lig PE=1 SV=1 184 682 8.0E-24
sp|A3DP49|DNLI_STAMF DNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=lig PE=1 SV=2 120 683 8.0E-24
sp|O59288|DNLI_PYRHO DNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=lig PE=3 SV=1 184 682 1.0E-23
sp|A0RWD6|DNLI_CENSY DNA ligase OS=Cenarchaeum symbiosum (strain A) GN=lig PE=3 SV=2 156 676 2.0E-23
sp|D2CJS7|DNLI_SULZI DNA ligase OS=Sulfophobococcus zilligii GN=lig PE=1 SV=1 184 683 8.0E-23
sp|O29632|DNLI_ARCFU DNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=lig PE=1 SV=2 143 680 1.0E-22
sp|Q8PTK1|DNLI2_METMA DNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lig2 PE=3 SV=1 183 675 1.0E-22
sp|Q6L195|DNLI_PICTO DNA ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=lig PE=3 SV=2 79 688 3.0E-22
sp|B8GGB8|DNLI_METPE DNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=lig PE=3 SV=1 183 677 4.0E-22
sp|A6UVC4|DNLI_META3 DNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=lig PE=3 SV=1 185 680 1.0E-21
sp|Q9HH07|DNLI_THEFM DNA ligase OS=Thermococcus fumicolans GN=lig PE=1 SV=1 184 680 1.0E-21
sp|Q5V4R0|DNLI_HALMA DNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lig PE=3 SV=1 185 683 2.0E-21
sp|Q1II25|DNLI_KORVE Probable DNA ligase OS=Koribacter versatilis (strain Ellin345) GN=lig PE=3 SV=1 145 680 3.0E-21
sp|A7IAA9|DNLI_METB6 DNA ligase OS=Methanoregula boonei (strain 6A8) GN=lig PE=3 SV=1 183 675 2.0E-20
sp|Q74M64|DNLI_NANEQ DNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=lig PE=3 SV=1 87 680 1.0E-19
sp|B6YTR4|DNLI_THEON DNA ligase OS=Thermococcus onnurineus (strain NA1) GN=lig PE=1 SV=1 184 682 1.0E-19
sp|A0B7F9|DNLI_METTP DNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=lig PE=3 SV=1 184 680 3.0E-19
sp|A2BJX6|DNLI_HYPBU DNA ligase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=lig PE=1 SV=1 184 683 5.0E-19
sp|A4F870|DNLI_SACEN Probable DNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=lig PE=3 SV=1 157 681 2.0E-18
sp|A8AB20|DNLI_IGNH4 DNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=lig PE=3 SV=1 183 680 2.0E-18
sp|Q3IPX0|DNLI_NATPD DNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=lig PE=3 SV=1 179 680 2.0E-18
sp|Q9HHC4|DNLI_THEKO DNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=lig PE=1 SV=2 184 682 4.0E-18
sp|Q57635|DNLI_METJA DNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=lig PE=3 SV=1 184 682 4.0E-18
sp|B9LUZ9|DNLI_HALLT DNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=lig PE=3 SV=1 212 675 8.0E-18
sp|A1RXA6|DNLI1_THEPD DNA ligase 1 OS=Thermofilum pendens (strain Hrk 5) GN=lig1 PE=3 SV=1 168 555 8.0E-18
sp|Q0W0X1|DNLI_METAR DNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=lig PE=3 SV=1 183 667 9.0E-18
sp|Q9HR35|DNLI_HALSA DNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lig PE=3 SV=1 202 686 3.0E-17
sp|B0R4C9|DNLI_HALS3 DNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=lig PE=3 SV=1 202 686 3.0E-17
sp|Q73V97|DNLI_MYCPA Probable DNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lig PE=3 SV=1 311 680 6.0E-17
sp|Q12X08|DNLI_METBU DNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=lig PE=3 SV=1 172 680 8.0E-17
sp|Q9FCB1|DNLI_STRCO Probable DNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lig PE=3 SV=1 157 677 1.0E-16
sp|B8JBM1|DNLI_ANAD2 Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lig PE=3 SV=1 157 680 2.0E-16
sp|A0QJL0|DNLI_MYCA1 Probable DNA ligase OS=Mycobacterium avium (strain 104) GN=lig PE=3 SV=1 288 680 2.0E-16
sp|C1AX87|DNLI_RHOOB Probable DNA ligase OS=Rhodococcus opacus (strain B4) GN=lig PE=3 SV=1 180 680 3.0E-16
sp|Q8TWN3|DNLI_METKA DNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=lig PE=3 SV=1 83 683 6.0E-16
sp|Q2IH69|DNLI_ANADE Probable DNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lig PE=3 SV=1 157 680 6.0E-16
sp|B8HCE1|DNLI_ARTCA Probable DNA ligase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=lig PE=3 SV=1 184 680 1.0E-15
sp|B1ZZL9|DNLI_OPITP Probable DNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=lig PE=3 SV=1 315 667 2.0E-15
sp|Q2FTH4|DNLI_METHJ DNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=lig PE=3 SV=1 161 679 4.0E-15
sp|Q18GX5|DNLI2_HALWD DNA ligase 2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=lig2 PE=3 SV=1 317 667 4.0E-15
sp|B1W5J2|DNLI_STRGG Probable DNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lig PE=3 SV=1 184 675 2.0E-14
sp|A5UKX2|DNLI_METS3 DNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=lig PE=3 SV=1 157 675 3.0E-14
sp|Q6LYM1|DNLI_METMP DNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=lig PE=3 SV=1 151 682 6.0E-14
sp|Q1BB26|DNLI_MYCSS Probable DNA ligase OS=Mycobacterium sp. (strain MCS) GN=lig PE=3 SV=1 311 679 6.0E-14
sp|A1UDY9|DNLI_MYCSK Probable DNA ligase OS=Mycobacterium sp. (strain KMS) GN=lig PE=3 SV=1 311 679 6.0E-14
sp|A3PXE2|DNLI_MYCSJ Probable DNA ligase OS=Mycobacterium sp. (strain JLS) GN=lig PE=3 SV=1 311 679 6.0E-14
sp|C5BW79|DNLI_BEUC1 Probable DNA ligase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=lig PE=3 SV=1 284 680 1.0E-13
sp|A2SR38|DNLI_METLZ DNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=lig PE=3 SV=1 161 677 3.0E-13
sp|D4GYZ4|DNLI_HALVD DNA ligase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lig PE=3 SV=1 317 680 3.0E-13
sp|Q50566|DNLI_METTH DNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=lig PE=3 SV=1 184 682 3.0E-13
sp|A0QUP1|DNLI_MYCS2 DNA ligase B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ligB PE=3 SV=1 317 675 4.0E-13
sp|A0PTC0|DNLI_MYCUA Probable DNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=lig PE=3 SV=1 184 680 4.0E-13
sp|A3CWP1|DNLI_METMJ DNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lig PE=3 SV=1 310 679 7.0E-13
sp|B4UIS1|DNLI_ANASK Probable DNA ligase OS=Anaeromyxobacter sp. (strain K) GN=lig PE=3 SV=1 284 680 8.0E-13
sp|B2HHE1|DNLI_MYCMM Probable DNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=lig PE=3 SV=2 184 680 9.0E-13
sp|B1L3K8|DNLI1_KORCO DNA ligase 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=lig1 PE=3 SV=1 161 683 1.0E-11
sp|A4FY19|DNLI_METM5 DNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=lig PE=3 SV=1 184 680 1.0E-11
sp|Q826P6|DNLI_STRAW Probable DNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lig PE=3 SV=1 317 677 4.0E-11
sp|A6VFQ9|DNLI_METM7 DNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=lig PE=3 SV=1 184 682 6.0E-11
sp|A9GU24|DNLI_SORC5 Probable DNA ligase OS=Sorangium cellulosum (strain So ce56) GN=lig PE=3 SV=1 184 680 1.0E-10
sp|A9AAX4|DNLI_METM6 DNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=lig PE=3 SV=1 184 682 1.0E-10
sp|Q2NHF9|DNLI_METST DNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=lig PE=3 SV=1 184 685 1.0E-10
sp|A1T6P2|DNLI_MYCVP Probable DNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=lig PE=3 SV=1 184 685 7.0E-10
sp|P54875|DNLI_METTF DNA ligase OS=Methanothermobacter thermautotrophicus GN=lig PE=3 SV=1 184 669 2.0E-09
sp|Q5YNY7|DNLI_NOCFA Probable DNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=lig PE=3 SV=1 309 680 3.0E-09
sp|A7HID3|DNLI_ANADF Probable DNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lig PE=3 SV=1 179 683 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006310 DNA recombination Yes
GO:0003677 DNA binding Yes
GO:0006281 DNA repair Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0005524 ATP binding Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0003909 DNA ligase activity No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006950 response to stress No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1082
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7415
Ophiocordyceps australis map64 (Brazil) OphauB2|7156
Ophiocordyceps camponoti-floridani Ophcf2|05942
Ophiocordyceps camponoti-rufipedis Ophun1|6983 (this protein)
Ophiocordyceps kimflemingae Ophio5|2717
Ophiocordyceps subramaniannii Hirsu2|10063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6983
MSPSSRNPDAVREDELQYGAVGMTREDMDEKYPNRPRNHSKTLPFHDLFIRLFNPLNENKKQPVRGKPLRGPAHG
PSPQEQRRRVIVSFIARWRTKVGDDFYPALRLILPDKDRDRGVYGLKENAIGKLLVKLTKIDKNSDDGYGLLHWR
IPGQTAASRLAGDFAGRCFEVLSKRPMRTDVGDMTIAEVNAQLDKLAAASGEAESLAVFETLYARMNAEELMWLI
RIVLKQLKVGASEKTMLHVWHPDGETLFNVSSSLQRVCWELHDPNVRLEREEAGVGLMQCFQPQLAQFQMPASFQ
KMVELLRPTEGDAEFWIEEKLDGERMQMHVVEDASHPGGWRFRFWSRKAKDYTYLYGDGLLDDSSSLTRHLKEVL
APGVRNLIVDGEMITWDMDLDKIVPFGTLKTAAISEQKKQTDSKDGGSNDGGHRPLFRVFDILYLNDKQLTQYTL
RDRRRALEKAIQPVHRRLEIHQVTRTTTADAIEPLLREVVANASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSE
FGESLDCLVIGGYYGSGRRGGMLSSFLCGLRVTANHIRAGADPEKCFSFFRVGGGFSADDYAEIRHRTDGKWHAW
DASRPPSEYIELAGGDKRQIERPDMWIRPRDSVVVSVKATSVAPSDSFARGVTLRFPRFRRLRLDRSWDSALTVE
EFEELRQKVDQESHEKAMTVEDTKRRKPKRVKRELVIAGDEGAPPPAAAEFSSGRPTGIFQGFEFSVLSDSPRPY
KKTKPQLEAIIKEKGGSISQRATALSRTVLVADKKTVKVASLIKAGAVDIIRPIWIRDCLEPGGGGGVPELLPYE
ERHLLHVTDATRATAAKNTDRFGDSFARSVSVEELKRLTDAMTVDVHDADEAVACLLAELEERNSGVSNMRAFMM
ARCVIRLLAADETDVTIRRTVDRLARYVRYAGGRCVGEDEEDTATHVVLVGEDVEKVRHLADEVRRRWTEGGKGL
ARVVSGRWIEECWGEKTLLDEERYAV*
Coding >Ophun1|6983
ATGTCACCGTCCTCCCGCAATCCGGATGCCGTCCGCGAAGACGAGCTGCAGTACGGCGCAGTTGGCATGACGCGC
GAAGACATGGATGAAAAGTATCCCAACCGGCCTCGCAATCACTCCAAGACGCTGCCCTTTCACGACCTCTTCATC
CGCCTCTTCAACCCACTCAACGAGAACAAGAAGCAGCCGGTCCGCGGAAAGCCTCTCCGCGGTCCCGCTCACGGA
CCATCACCCCAGGAGCAACGGAGGCGCGTCATCGTGTCCTTTATCGCGAGGTGGCGCACCAAGGTCGGCGACGAC
TTCTACCCGGCTCTACGTCTCATCCTACCAGACAAGGATCGTGACCGTGGCGTCTACGGACTCAAGGAGAATGCC
ATCGGGAAACTTCTCGTAAAGCTAACCAAGATCGACAAGAACTCGGACGACGGCTATGGGCTGCTTCACTGGAGG
ATCCCTGGCCAGACGGCCGCCTCCCGCCTCGCCGGTGACTTTGCCGGTCGTTGCTTCGAGGTCCTCTCCAAGCGG
CCTATGAGGACGGATGTCGGTGATATGACCATTGCCGAGGTCAACGCCCAGCTCGACAAGTTGGCCGCCGCCTCC
GGTGAGGCCGAGAGCCTGGCCGTCTTCGAGACGCTCTACGCCCGCATGAACGCCGAGGAACTCATGTGGCTCATC
CGCATTGTTCTCAAACAGCTCAAGGTCGGCGCCTCGGAGAAGACGATGCTCCACGTCTGGCATCCGGATGGCGAG
ACGCTCTTCAACGTCTCGTCCAGCCTGCAGCGCGTGTGTTGGGAGCTACACGACCCCAACGTCAGGCTCGAGCGG
GAAGAGGCTGGTGTTGGCCTCATGCAGTGCTTCCAGCCGCAGCTGGCTCAGTTTCAGATGCCGGCCTCGTTTCAG
AAAATGGTCGAGCTCCTGCGGCCGACTGAAGGCGATGCCGAGTTTTGGATCGAGGAGAAGCTCGACGGTGAGCGT
ATGCAGATGCACGTCGTCGAGGACGCCAGCCATCCGGGCGGCTGGCGCTTCCGCTTCTGGTCTCGAAAGGCCAAA
GACTACACCTACCTGTACGGTGACGGCCTGCTCGATGATAGTTCTAGCCTGACACGTCACCTAAAAGAGGTGTTG
GCGCCCGGCGTCCGCAACCTCATTGTCGACGGTGAGATGATCACCTGGGACATGGACCTCGACAAGATTGTACCC
TTTGGTACGCTCAAGACGGCGGCCATCTCCGAGCAGAAGAAGCAAACGGACAGCAAAGATGGCGGTAGCAACGAC
GGCGGCCATCGCCCCCTGTTTCGTGTCTTTGACATCCTCTACCTCAATGACAAGCAGCTGACGCAATACACGCTG
CGGGATCGACGTCGGGCGTTGGAAAAGGCCATCCAGCCCGTTCACCGGCGGCTTGAGATTCACCAAGTGACGCGG
ACGACGACAGCCGATGCCATCGAGCCGCTTCTGCGTGAAGTAGTGGCAAACGCGTCCGAGGGACTGGTTCTCAAG
AACCCGCGGTCCATGTACCGCCTCAACAGCCGCAACGACGACTGGCTCAAGGTGAAGCCCGAGTACATGTCCGAG
TTTGGCGAGTCTCTCGACTGCCTCGTCATCGGCGGCTATTACGGCTCGGGTCGGCGAGGCGGCATGCTGTCGAGC
TTCCTGTGCGGTCTCCGTGTGACGGCGAACCACATCCGTGCCGGTGCCGACCCGGAGAAGTGCTTCAGCTTCTTC
CGTGTCGGCGGCGGCTTCTCCGCAGACGACTATGCCGAGATTCGTCACCGGACTGACGGCAAATGGCACGCCTGG
GATGCGTCCCGCCCGCCGTCCGAGTATATCGAGCTGGCTGGCGGCGATAAGCGGCAGATTGAGCGGCCGGACATG
TGGATTCGTCCCAGAGACTCTGTTGTCGTGTCCGTTAAGGCTACGAGCGTCGCTCCGTCTGACAGCTTCGCCCGC
GGCGTCACGCTGCGCTTCCCCCGATTCAGGCGGTTGCGTCTCGATCGCAGCTGGGACTCGGCCCTGACGGTTGAG
GAGTTTGAAGAGCTGAGGCAAAAGGTCGATCAAGAGTCCCATGAAAAGGCCATGACGGTCGAGGACACCAAGAGG
CGGAAACCGAAGCGGGTAAAGAGGGAGCTCGTCATCGCGGGAGACGAGGGCGCGCCACCGCCAGCAGCCGCCGAG
TTCTCGTCGGGCCGCCCAACGGGCATCTTTCAGGGTTTCGAGTTCAGCGTCCTGTCCGACTCGCCCCGGCCGTAC
AAGAAGACCAAGCCGCAACTGGAAGCCATCATCAAGGAGAAGGGCGGCTCCATCTCTCAGCGGGCGACGGCGCTC
TCCCGGACGGTGCTGGTGGCTGACAAGAAGACGGTCAAGGTGGCAAGTCTCATCAAGGCCGGCGCCGTCGACATT
ATCCGTCCGATCTGGATCCGGGACTGTCTGGAGCCGGGAGGCGGCGGCGGAGTTCCCGAACTGTTACCGTACGAG
GAGAGGCATCTGCTGCATGTGACGGATGCGACACGGGCGACGGCAGCGAAGAACACGGACCGCTTCGGCGACAGC
TTCGCTCGCAGTGTGTCGGTAGAGGAGTTGAAGCGTCTGACGGACGCCATGACGGTCGACGTACATGACGCGGAC
GAAGCTGTGGCCTGTCTGCTGGCGGAACTCGAGGAGCGGAATTCAGGGGTTTCCAACATGCGCGCCTTTATGATG
GCCCGGTGCGTCATACGACTGCTGGCAGCGGACGAGACCGACGTGACTATCAGAAGGACTGTTGACAGGCTGGCG
CGCTACGTTCGATACGCAGGAGGCCGGTGCGTCGGCGAAGATGAAGAGGACACGGCTACGCACGTCGTCTTGGTG
GGAGAGGATGTCGAGAAGGTGAGGCACCTGGCGGATGAGGTGCGTCGACGATGGACAGAGGGGGGAAAGGGACTG
GCGAGGGTGGTGTCGGGTCGGTGGATTGAGGAGTGCTGGGGGGAGAAGACGCTGCTGGACGAGGAGCGATATGCG
GTTTGA
Transcript >Ophun1|6983
ATGTCACCGTCCTCCCGCAATCCGGATGCCGTCCGCGAAGACGAGCTGCAGTACGGCGCAGTTGGCATGACGCGC
GAAGACATGGATGAAAAGTATCCCAACCGGCCTCGCAATCACTCCAAGACGCTGCCCTTTCACGACCTCTTCATC
CGCCTCTTCAACCCACTCAACGAGAACAAGAAGCAGCCGGTCCGCGGAAAGCCTCTCCGCGGTCCCGCTCACGGA
CCATCACCCCAGGAGCAACGGAGGCGCGTCATCGTGTCCTTTATCGCGAGGTGGCGCACCAAGGTCGGCGACGAC
TTCTACCCGGCTCTACGTCTCATCCTACCAGACAAGGATCGTGACCGTGGCGTCTACGGACTCAAGGAGAATGCC
ATCGGGAAACTTCTCGTAAAGCTAACCAAGATCGACAAGAACTCGGACGACGGCTATGGGCTGCTTCACTGGAGG
ATCCCTGGCCAGACGGCCGCCTCCCGCCTCGCCGGTGACTTTGCCGGTCGTTGCTTCGAGGTCCTCTCCAAGCGG
CCTATGAGGACGGATGTCGGTGATATGACCATTGCCGAGGTCAACGCCCAGCTCGACAAGTTGGCCGCCGCCTCC
GGTGAGGCCGAGAGCCTGGCCGTCTTCGAGACGCTCTACGCCCGCATGAACGCCGAGGAACTCATGTGGCTCATC
CGCATTGTTCTCAAACAGCTCAAGGTCGGCGCCTCGGAGAAGACGATGCTCCACGTCTGGCATCCGGATGGCGAG
ACGCTCTTCAACGTCTCGTCCAGCCTGCAGCGCGTGTGTTGGGAGCTACACGACCCCAACGTCAGGCTCGAGCGG
GAAGAGGCTGGTGTTGGCCTCATGCAGTGCTTCCAGCCGCAGCTGGCTCAGTTTCAGATGCCGGCCTCGTTTCAG
AAAATGGTCGAGCTCCTGCGGCCGACTGAAGGCGATGCCGAGTTTTGGATCGAGGAGAAGCTCGACGGTGAGCGT
ATGCAGATGCACGTCGTCGAGGACGCCAGCCATCCGGGCGGCTGGCGCTTCCGCTTCTGGTCTCGAAAGGCCAAA
GACTACACCTACCTGTACGGTGACGGCCTGCTCGATGATAGTTCTAGCCTGACACGTCACCTAAAAGAGGTGTTG
GCGCCCGGCGTCCGCAACCTCATTGTCGACGGTGAGATGATCACCTGGGACATGGACCTCGACAAGATTGTACCC
TTTGGTACGCTCAAGACGGCGGCCATCTCCGAGCAGAAGAAGCAAACGGACAGCAAAGATGGCGGTAGCAACGAC
GGCGGCCATCGCCCCCTGTTTCGTGTCTTTGACATCCTCTACCTCAATGACAAGCAGCTGACGCAATACACGCTG
CGGGATCGACGTCGGGCGTTGGAAAAGGCCATCCAGCCCGTTCACCGGCGGCTTGAGATTCACCAAGTGACGCGG
ACGACGACAGCCGATGCCATCGAGCCGCTTCTGCGTGAAGTAGTGGCAAACGCGTCCGAGGGACTGGTTCTCAAG
AACCCGCGGTCCATGTACCGCCTCAACAGCCGCAACGACGACTGGCTCAAGGTGAAGCCCGAGTACATGTCCGAG
TTTGGCGAGTCTCTCGACTGCCTCGTCATCGGCGGCTATTACGGCTCGGGTCGGCGAGGCGGCATGCTGTCGAGC
TTCCTGTGCGGTCTCCGTGTGACGGCGAACCACATCCGTGCCGGTGCCGACCCGGAGAAGTGCTTCAGCTTCTTC
CGTGTCGGCGGCGGCTTCTCCGCAGACGACTATGCCGAGATTCGTCACCGGACTGACGGCAAATGGCACGCCTGG
GATGCGTCCCGCCCGCCGTCCGAGTATATCGAGCTGGCTGGCGGCGATAAGCGGCAGATTGAGCGGCCGGACATG
TGGATTCGTCCCAGAGACTCTGTTGTCGTGTCCGTTAAGGCTACGAGCGTCGCTCCGTCTGACAGCTTCGCCCGC
GGCGTCACGCTGCGCTTCCCCCGATTCAGGCGGTTGCGTCTCGATCGCAGCTGGGACTCGGCCCTGACGGTTGAG
GAGTTTGAAGAGCTGAGGCAAAAGGTCGATCAAGAGTCCCATGAAAAGGCCATGACGGTCGAGGACACCAAGAGG
CGGAAACCGAAGCGGGTAAAGAGGGAGCTCGTCATCGCGGGAGACGAGGGCGCGCCACCGCCAGCAGCCGCCGAG
TTCTCGTCGGGCCGCCCAACGGGCATCTTTCAGGGTTTCGAGTTCAGCGTCCTGTCCGACTCGCCCCGGCCGTAC
AAGAAGACCAAGCCGCAACTGGAAGCCATCATCAAGGAGAAGGGCGGCTCCATCTCTCAGCGGGCGACGGCGCTC
TCCCGGACGGTGCTGGTGGCTGACAAGAAGACGGTCAAGGTGGCAAGTCTCATCAAGGCCGGCGCCGTCGACATT
ATCCGTCCGATCTGGATCCGGGACTGTCTGGAGCCGGGAGGCGGCGGCGGAGTTCCCGAACTGTTACCGTACGAG
GAGAGGCATCTGCTGCATGTGACGGATGCGACACGGGCGACGGCAGCGAAGAACACGGACCGCTTCGGCGACAGC
TTCGCTCGCAGTGTGTCGGTAGAGGAGTTGAAGCGTCTGACGGACGCCATGACGGTCGACGTACATGACGCGGAC
GAAGCTGTGGCCTGTCTGCTGGCGGAACTCGAGGAGCGGAATTCAGGGGTTTCCAACATGCGCGCCTTTATGATG
GCCCGGTGCGTCATACGACTGCTGGCAGCGGACGAGACCGACGTGACTATCAGAAGGACTGTTGACAGGCTGGCG
CGCTACGTTCGATACGCAGGAGGCCGGTGCGTCGGCGAAGATGAAGAGGACACGGCTACGCACGTCGTCTTGGTG
GGAGAGGATGTCGAGAAGGTGAGGCACCTGGCGGATGAGGTGCGTCGACGATGGACAGAGGGGGGAAAGGGACTG
GCGAGGGTGGTGTCGGGTCGGTGGATTGAGGAGTGCTGGGGGGAGAAGACGCTGCTGGACGAGGAGCGATATGCG
GTTTGA
Gene >Ophun1|6983
ATGTCACCGTCCTCCCGCAATCCGGATGCCGTCCGCGAAGACGAGCTGCAGTACGGCGCAGTTGGCATGACGCGC
GAAGACATGGATGAAAAGTATACCATCAGACACTTGTCTCGTCACCTCCCTCGTCTGCTGACTACCACTCAAGGT
ATCCCAACCGGCCTCGCAATCACTCCAAGACGCTGCCCTTTCACGACCTCTTCATCCGCCTCTTCAACCCACTCA
ACGAGAACAAGAAGCAGCCGGTCCGCGGAAAGCCTCTCCGCGGTCCCGCTCACGGACCATCACCCCAGGAGCAAC
GGAGGCGCGTCATCGTGTCCTTTATCGCGAGGTGGCGCACCAAGGTCGGCGACGACTTCTACCCGGCTCTACGTC
TCATCCTACCAGACAAGGATCGTGACCGTGGCGTCTACGGACTCAAGGAGAATGCCATCGGGAAACTTCTCGTAA
AGCTAACCAAGATCGACAAGAACTCGGACGACGGCTATGGGCTGCTTCACTGGAGGATCCCTGGCCAGACGGCCG
CCTCCCGCCTCGCCGGTGACTTTGCCGGTCGTTGCTTCGAGGTCCTCTCCAAGCGGCCTATGAGGACGGATGTCG
GTGATATGACCATTGCCGAGGTCAACGCCCAGCTCGACAAGTTGGCCGCCGCCTCCGGTGAGGCCGAGAGCCTGG
CCGTCTTCGAGACGCTCTACGCCCGCATGAACGCCGAGGAACTCATGTGGCTCATCCGCATTGTTCTCAAACAGC
TCAAGGTCGGCGCCTCGGAGAAGACGATGCTCCACGTCTGGCATCCGGATGGCGAGACGCTCTTCAACGTCTCGT
CCAGCCTGCAGCGCGTGTGTTGGGAGCTACACGACCCCAACGTCAGGCTCGAGCGGGAAGAGGCTGGTGTTGGCC
TCATGCAGTGCTTCCAGCCGCAGCTGGCTCAGTTTCAGATGCCGGCCTCGTTTCAGAAAATGGTCGAGCTCCTGC
GGCCGACTGAAGGCGATGCCGAGTTTTGGATCGAGGAGAAGCTCGACGGTGAGCGTATGCAGATGCACGTCGTCG
AGGACGCCAGCCATCCGGGCGGCTGGCGCTTCCGCTTCTGGTCTCGAAAGGCCAAAGACTACACCTACCTGTACG
GTGACGGCCTGCTCGATGATAGTTCTAGCCTGACACGTCACCTAAAAGAGGTGTTGGCGCCCGGCGTCCGCAACC
TCATTGTCGACGGTGAGATGATCACCTGGGACATGGACCTCGACAAGATTGTACCCTTTGGTACGCTCAAGACGG
CGGCCATCTCCGAGCAGAAGAAGCAAACGGACAGCAAAGATGGCGGTAGCAACGACGGCGGCCATCGCCCCCTGT
TTCGTGTCTTTGACATCCTCTACCTCAATGACAAGCAGCTGACGCAATACACGCTGCGGGATCGACGTCGGGCGT
TGGAAAAGGCCATCCAGCCCGTTCACCGGCGGCTTGAGATTCACCAAGTGACGCGGACGACGACAGCCGATGCCA
TCGAGCCGCTTCTGCGTGAAGTAGTGGCAAACGCGTCCGAGGGACTGGTTCTCAAGAACCCGCGGTCCATGTACC
GCCTCAACAGCCGCAACGACGACTGGCTCAAGGTGAAGCCCGAGTACATGTCCGAGTTTGGCGAGTCTCTCGACT
GCCTCGTCATCGGCGGCTATTACGGCTCGGGTCGGCGAGGCGGCATGCTGTCGAGCTTCCTGTGCGGTCTCCGTG
TGACGGCGAACCACATCCGTGCCGGTGCCGACCCGGAGAAGTGCTTCAGCTTCTTCCGTGTCGGCGGCGGCTTCT
CCGCAGACGACTATGCCGAGATTCGTCACCGGACTGACGGCAAATGGCACGCCTGGGATGCGTCCCGCCCGCCGT
CCGAGTATATCGAGCTGGCTGGCGGCGATAAGCGGCAGATTGAGCGGCCGGACATGTGGATTCGTCCCAGAGACT
CTGTTGTCGTGTCCGTTAAGGCTACGAGCGTCGCTCCGTCTGACAGCTTCGCCCGCGGCGTCACGCTGCGCTTCC
CCCGATTCAGGCGGTTGCGTCTCGATCGCAGCTGGGACTCGGCCCTGACGGTTGAGGAGTTTGAAGAGCTGAGGC
AAAAGGTCGATCAAGAGTCCCATGAAAAGGCCATGACGGTCGAGGACACCAAGAGGCGGAAACCGAAGCGGGTAA
AGAGGGAGCTCGTCATCGCGGGAGACGAGGGCGCGCCACCGCCAGCAGCCGCCGAGTTCTCGTCGGGCCGCCCAA
CGGGCATCTTTCAGGGTTTCGAGTTCAGCGTCCTGTCCGACTCGCCCCGGCCGTACAAGAAGACCAAGCCGCAAC
TGGAAGCCATCATCAAGGAGAAGGGCGGCTCCATCTCTCAGCGGGCGACGGCGCTCTCCCGGACGGTGCTGGTGG
CTGACAAGAAGACGGTCAAGGTGGCAAGTCTCATCAAGGCCGGCGCCGTCGACATTATCCGTCCGATCTGGATCC
GGGACTGTCTGGAGCCGGGAGGCGGCGGCGGAGTTCCCGAACTGTTACCGTACGAGGAGAGGCATCTGCTGCATG
TGACGGATGCGACACGGGCGACGGCAGCGAAGAACACGGACCGCTTCGGCGACAGCTTCGCTCGCAGTGTGTCGG
TAGAGGAGTTGAAGCGTCTGACGGACGCCATGACGGTCGACGTACATGACGCGGACGAAGCTGTGGCCTGTCTGC
TGGCGGAACTCGAGGAGCGGAATTCAGGGGTTTCCAACATGCGCGCCTTTATGATGGCCCGGTGCGTCATACGAC
TGCTGGCAGCGGACGAGACCGACGTGACTATCAGAAGGACTGTTGACAGGCTGGCGCGCTACGTTCGATACGCAG
GAGGCCGGTGCGTCGGCGAAGATGAAGAGGACACGGCTACGCACGTCGTCTTGGTGGGAGAGGATGTCGAGAAGG
TGAGGCACCTGGCGGATGAGGTGCGTCGACGATGGACAGAGGGGGGAAAGGGACTGGCGAGGGTGGTGTCGGGTC
GGTGGATTGAGGAGTGCTGGGGGGAGAAGACGCTGCTGGACGAGGAGCGATATGCGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail