Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6981
Gene name
LocationContig_818:205..1153
Strand+
Gene length (bp)948
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 1.8E-23 22 252

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9WZ31|CORA_THEMA Magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=corA PE=1 SV=1 16 271 1.0E-20
sp|O31543|YFJQ_BACSU Putative metal ion transporter YfjQ OS=Bacillus subtilis (strain 168) GN=yfjQ PE=3 SV=1 156 253 1.0E-09

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 202 224 22
2 234 253 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6981
MERESPLAPRNRAVLAEQVSIFLTSDNTVVSFFESSAADVERPIVTRLSTAGTILRASCDASLLVQALLDAIVDL
ALPLTNIYTDLLCDLELDVLTAPSIRQSRSLYLCIAEINKMLRCLQPVDGLVNALREHRSPNRAGRYIGEHHQSV
IVSSVTCTYLGDVLDHCIVICDALQQLKQSSEDLIGLIFNTISATQNESMRQLTTVTIIFLPLTFITGFFGQNFN
NFPELHHGIWYFWACAVPTAMATVLILMHDMIYSWIVRLFRRKRILNLRRARRASWLKPKRNLSLSRQ*
Coding >Ophun1|6981
ATGGAGAGGGAATCTCCGCTGGCGCCGAGGAATAGGGCTGTTTTGGCGGAGCAGGTTTCCATCTTCCTGACCAGC
GATAACACCGTCGTTTCCTTCTTCGAGTCTTCGGCTGCAGACGTTGAGCGTCCCATCGTCACCCGTCTCAGCACA
GCGGGCACCATCCTCCGCGCCTCCTGCGACGCCTCTCTCCTCGTCCAAGCCCTTCTGGACGCCATCGTCGATCTC
GCCCTCCCGCTAACAAACATCTACACCGACCTCCTCTGCGATCTAGAACTCGACGTCTTGACGGCGCCGTCTATC
CGGCAGAGCAGGTCGCTCTATCTCTGCATCGCCGAGATCAACAAGATGCTTCGCTGTTTGCAGCCGGTGGATGGG
CTTGTCAATGCGTTAAGGGAGCATCGCTCTCCGAATCGGGCGGGGAGGTATATCGGTGAGCATCATCAGAGCGTC
ATCGTCTCGTCTGTTACGTGCACGTATCTGGGAGACGTGCTGGATCACTGTATTGTGATTTGTGATGCGCTGCAG
CAGTTGAAGCAGTCGAGTGAGGATCTCATCGGTCTCATCTTCAACACCATCTCTGCTACGCAGAATGAGTCGATG
AGGCAGTTGACGACTGTCACCATCATCTTCTTACCCCTGACTTTCATCACGGGATTCTTTGGGCAGAACTTTAAC
AACTTTCCGGAGCTGCACCACGGGATATGGTACTTCTGGGCCTGTGCCGTTCCCACCGCAATGGCCACCGTCTTG
ATCCTCATGCACGACATGATCTACTCCTGGATCGTCCGTCTCTTCCGCCGCAAGAGGATCCTCAACCTCCGTCGA
GCCCGTCGCGCCTCGTGGCTCAAGCCCAAGCGCAACCTCAGCCTGTCTCGCCAGTAA
Transcript >Ophun1|6981
ATGGAGAGGGAATCTCCGCTGGCGCCGAGGAATAGGGCTGTTTTGGCGGAGCAGGTTTCCATCTTCCTGACCAGC
GATAACACCGTCGTTTCCTTCTTCGAGTCTTCGGCTGCAGACGTTGAGCGTCCCATCGTCACCCGTCTCAGCACA
GCGGGCACCATCCTCCGCGCCTCCTGCGACGCCTCTCTCCTCGTCCAAGCCCTTCTGGACGCCATCGTCGATCTC
GCCCTCCCGCTAACAAACATCTACACCGACCTCCTCTGCGATCTAGAACTCGACGTCTTGACGGCGCCGTCTATC
CGGCAGAGCAGGTCGCTCTATCTCTGCATCGCCGAGATCAACAAGATGCTTCGCTGTTTGCAGCCGGTGGATGGG
CTTGTCAATGCGTTAAGGGAGCATCGCTCTCCGAATCGGGCGGGGAGGTATATCGGTGAGCATCATCAGAGCGTC
ATCGTCTCGTCTGTTACGTGCACGTATCTGGGAGACGTGCTGGATCACTGTATTGTGATTTGTGATGCGCTGCAG
CAGTTGAAGCAGTCGAGTGAGGATCTCATCGGTCTCATCTTCAACACCATCTCTGCTACGCAGAATGAGTCGATG
AGGCAGTTGACGACTGTCACCATCATCTTCTTACCCCTGACTTTCATCACGGGATTCTTTGGGCAGAACTTTAAC
AACTTTCCGGAGCTGCACCACGGGATATGGTACTTCTGGGCCTGTGCCGTTCCCACCGCAATGGCCACCGTCTTG
ATCCTCATGCACGACATGATCTACTCCTGGATCGTCCGTCTCTTCCGCCGCAAGAGGATCCTCAACCTCCGTCGA
GCCCGTCGCGCCTCGTGGCTCAAGCCCAAGCGCAACCTCAGCCTGTCTCGCCAGTAA
Gene >Ophun1|6981
ATGGAGAGGGAATCTCCGCTGGCGCCGAGGAATAGGGCTGTTTTGGCGGAGCAGGTTTCCATCTTCCTGACCAGC
GATAACACCGTCGTTTCCTTCTTCGAGTCTTCGGCTGCAGACGTTGAGCGTCCCATCGTCACCCGTCTCAGCACA
GCGGGCACCATCCTCCGCGCCTCCTGCGACGCCTCTCTCCTCGTCCAAGCCCTTCTGGACGCCATCGTCGATCTC
GCCCTCCCGCTAACAAACATCTACACCGACCTCCTCTGCGATCTAGAACTCGACGTCTTGACGGCGCCGTCTATC
CGGCAGAGCAGGTCGCTCTATCTCTGCATCGCCGAGATCAACAAGATGCTTCGCTGTTTGCAGCCGGTGGATGGG
CTTGTCAATGCGTTAAGGGAGCATCGCTCTCCGAATCGGGCGGGGAGGTATATCGGTGAGCATCATCAGAGCGTC
ATCGTCTCGTCTGTTACGTGCACGTATCTGGGAGACGTGCTGGATCACTGTATTGTGATTTGTGATGCGCTGCAG
CAGTTGAAGCAGTCGAGTGAGGATCTCATCGGTCTCATCTTCAACACCATCTCTGCTACGCAGAATGAGTCGATG
AGGCAGTTGACGACTGTCACCATCATCTTCTTACCCCTGACTTTCATCACGGGATTCTTTGGGCAGAACTTTAAC
AACTTTCCGGAGCTGCACCACGGGATATGGTACTTGTGAGTCTTGCCCGAGTTTCCCTCTCATCTCTTCTGGGTT
TCCATCTCTAACTCTCATCCTACCAGCTGGGCCTGTGCCGTTCCCACCGCAATGGCCACCGTCTTGATCCTCATG
CACGACATGATCTACTCCTGGATCGTCCGTCTCTTCCGCCGCAAGAGGATCCTCAACCTCCGTCGAGCCCGTCGC
GCCTCGTGGCTCAAGCCCAAGCGCAACCTCAGCCTGTCTCGCCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail