Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6973
Gene name
LocationContig_815:3482..4034
Strand-
Gene length (bp)552
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999683

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7765
Ophiocordyceps camponoti-rufipedis Ophun1|6973 (this protein)
Ophiocordyceps kimflemingae Ophio5|3432
Ophiocordyceps subramaniannii Hirsu2|4815
Ophiocordyceps subramaniannii Hirsu2|5464
Ophiocordyceps subramaniannii Hirsu2|7643

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6973
MKPTPILLLAALPTALPQKLPWLEPPSNPTSCIPLRSSEKDCGTRLFCNHHDFEPGPREYPNAQACFDAHHPAPL
LPWIPAPEVDRNDDSCWEHDEDSCPRFCEEGGKYREEQQCGTEVWCSYFDENRWWPFLFESKQACLDAHASNSTE
APAAMNSTKAAHGANSIEPAGAWSDTGAEVEVD*
Coding >Ophun1|6973
ATGAAGCCCACCCCCATCCTCCTCCTCGCCGCCCTCCCCACCGCCCTCCCCCAAAAACTCCCCTGGCTCGAACCA
CCCTCGAACCCAACAAGCTGCATCCCCCTCCGCTCCTCCGAGAAAGACTGCGGCACCCGCCTCTTCTGCAACCAC
CACGACTTCGAGCCCGGACCGAGAGAGTACCCCAACGCCCAGGCCTGCTTCGACGCCCACCATCCCGCCCCGCTG
CTCCCATGGATCCCGGCCCCCGAGGTGGACCGCAACGACGACTCGTGCTGGGAGCATGACGAGGATTCGTGCCCT
CGCTTCTGTGAGGAGGGGGGGAAGTATAGGGAAGAGCAGCAGTGTGGGACGGAGGTTTGGTGCTCGTATTTCGAT
GAGAATCGCTGGTGGCCGTTTTTGTTTGAGAGCAAGCAGGCCTGTCTAGATGCTCACGCCTCCAACTCGACCGAG
GCGCCGGCTGCCATGAACTCGACCAAGGCGGCTCACGGCGCAAACTCGATAGAGCCGGCTGGCGCATGGAGTGAC
ACGGGGGCGGAGGTGGAGGTGGACTAG
Transcript >Ophun1|6973
ATGAAGCCCACCCCCATCCTCCTCCTCGCCGCCCTCCCCACCGCCCTCCCCCAAAAACTCCCCTGGCTCGAACCA
CCCTCGAACCCAACAAGCTGCATCCCCCTCCGCTCCTCCGAGAAAGACTGCGGCACCCGCCTCTTCTGCAACCAC
CACGACTTCGAGCCCGGACCGAGAGAGTACCCCAACGCCCAGGCCTGCTTCGACGCCCACCATCCCGCCCCGCTG
CTCCCATGGATCCCGGCCCCCGAGGTGGACCGCAACGACGACTCGTGCTGGGAGCATGACGAGGATTCGTGCCCT
CGCTTCTGTGAGGAGGGGGGGAAGTATAGGGAAGAGCAGCAGTGTGGGACGGAGGTTTGGTGCTCGTATTTCGAT
GAGAATCGCTGGTGGCCGTTTTTGTTTGAGAGCAAGCAGGCCTGTCTAGATGCTCACGCCTCCAACTCGACCGAG
GCGCCGGCTGCCATGAACTCGACCAAGGCGGCTCACGGCGCAAACTCGATAGAGCCGGCTGGCGCATGGAGTGAC
ACGGGGGCGGAGGTGGAGGTGGACTAG
Gene >Ophun1|6973
ATGAAGCCCACCCCCATCCTCCTCCTCGCCGCCCTCCCCACCGCCCTCCCCCAAAAACTCCCCTGGCTCGAACCA
CCCTCGAACCCAACAAGCTGCATCCCCCTCCGCTCCTCCGAGAAAGACTGCGGCACCCGCCTCTTCTGCAACCAC
CACGACTTCGAGCCCGGACCGAGAGAGTACCCCAACGCCCAGGCCTGCTTCGACGCCCACCATCCCGCCCCGCTG
CTCCCATGGATCCCGGCCCCCGAGGTGGACCGCAACGACGACTCGTGCTGGGAGCATGACGAGGATTCGTGCCCT
CGCTTCTGTGAGGAGGGGGGGAAGTATAGGGAAGAGCAGCAGTGTGGGACGGAGGTTTGGTGCTCGTATTTCGAT
GAGAATCGCTGGTGGCCGTTTTTGTTTGAGAGCAAGCAGGCCTGTCTAGATGCTCACGCCTCCAACTCGACCGAG
GCGCCGGCTGCCATGAACTCGACCAAGGCGGCTCACGGCGCAAACTCGATAGAGCCGGCTGGCGCATGGAGTGAC
ACGGGGGCGGAGGTGGAGGTGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail