Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6969
Gene name
LocationContig_814:2433..3585
Strand+
Gene length (bp)1152
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08620 RPAP1_C RPAP1-like, C-terminal 2.5E-29 251 317
PF08621 RPAP1_N RPAP1-like, N-terminal 6.3E-17 70 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04418|RBA50_YEAST RNA polymerase II-associated protein RBA50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBA50 PE=1 SV=2 6 375 2.0E-53
sp|O43088|RBA50_SCHPO RNA polymerase II-associated protein rba50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rba50 PE=3 SV=1 183 370 2.0E-41
sp|Q80TE0|RPAP1_MOUSE RNA polymerase II-associated protein 1 OS=Mus musculus GN=Rpap1 PE=1 SV=2 66 323 2.0E-13
sp|A0JN53|RPAP1_BOVIN RNA polymerase II-associated protein 1 OS=Bos taurus GN=RPAP1 PE=2 SV=1 66 323 3.0E-12
sp|Q9BWH6|RPAP1_HUMAN RNA polymerase II-associated protein 1 OS=Homo sapiens GN=RPAP1 PE=1 SV=3 66 323 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04418|RBA50_YEAST RNA polymerase II-associated protein RBA50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBA50 PE=1 SV=2 6 375 2.0E-53
sp|O43088|RBA50_SCHPO RNA polymerase II-associated protein rba50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rba50 PE=3 SV=1 183 370 2.0E-41
sp|Q80TE0|RPAP1_MOUSE RNA polymerase II-associated protein 1 OS=Mus musculus GN=Rpap1 PE=1 SV=2 66 323 2.0E-13
sp|A0JN53|RPAP1_BOVIN RNA polymerase II-associated protein 1 OS=Bos taurus GN=RPAP1 PE=2 SV=1 66 323 3.0E-12
sp|Q9BWH6|RPAP1_HUMAN RNA polymerase II-associated protein 1 OS=Homo sapiens GN=RPAP1 PE=1 SV=3 66 323 5.0E-12
sp|Q3T1I9|RPAP1_RAT RNA polymerase II-associated protein 1 OS=Rattus norvegicus GN=Rpap1 PE=1 SV=1 68 323 2.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6303
Ophiocordyceps australis map64 (Brazil) OphauB2|4051
Ophiocordyceps camponoti-floridani Ophcf2|03203
Ophiocordyceps camponoti-rufipedis Ophun1|6969 (this protein)
Ophiocordyceps kimflemingae Ophio5|7530
Ophiocordyceps subramaniannii Hirsu2|4404

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6969
MDPTLLIGDIVERDSSDSSSKPVEFRAPKATATGFPRHRHRWRPKSDEANKARPASPPQAAASFDETERRRIDHE
NRQKLANMTPQEIAQAQQDIINGLNPALVRRLLQRATIDDDPTPSPFDTQEAPPEIRIEPPETTSNVHAPAHRPP
TPETKTAKAPYDEDQAPAQIPADLFPITNLPKTTHFPAPPALPDLDPSEPDFLATLHEKYFPNLPADPSKLAWMA
PVPTQDSPADKDSPYYPHPEIGVSALRFDFRGRFLSPRVSRSIPSTKGLHHHGEAPEAAGYTIAELARLARSAVP
AQRCMAYQTLGRILYRLGRGEWGKTEDDPIAMGVWSSIKQGRVLESLFEAASGEGGHRGSRAYATEALWLFDKGG
WKEKHKGR*
Coding >Ophun1|6969
ATGGATCCGACGCTGCTTATAGGCGACATCGTCGAGCGAGATTCTTCGGACTCATCGAGCAAGCCAGTCGAGTTC
CGCGCGCCGAAAGCCACTGCCACGGGCTTTCCACGACACAGACATAGATGGCGGCCCAAGTCCGACGAGGCGAAC
AAGGCCCGACCTGCGTCGCCGCCCCAGGCCGCTGCAAGCTTCGACGAGACAGAAAGACGGCGTATAGACCATGAG
AATCGACAGAAACTCGCAAACATGACGCCGCAGGAGATTGCGCAGGCCCAGCAGGACATCATCAACGGCCTGAAT
CCTGCCTTAGTGCGACGACTCCTCCAGCGGGCCACCATAGACGACGACCCTACGCCCTCGCCCTTTGATACGCAG
GAAGCGCCGCCTGAGATACGGATTGAACCCCCAGAGACTACGTCGAATGTTCACGCCCCGGCGCATCGCCCGCCC
ACTCCCGAGACCAAGACCGCAAAAGCCCCCTACGATGAGGATCAGGCACCGGCACAAATACCCGCAGACCTGTTT
CCCATCACCAACCTGCCCAAGACGACGCATTTTCCAGCACCTCCAGCTCTTCCCGACCTGGACCCGTCTGAACCC
GATTTCCTGGCAACACTGCACGAAAAGTACTTCCCCAACCTGCCCGCAGACCCGAGCAAGCTCGCCTGGATGGCG
CCGGTGCCCACCCAGGACAGTCCAGCCGACAAGGATTCGCCGTACTATCCTCACCCCGAGATTGGCGTTTCGGCC
TTGCGATTCGACTTCCGCGGCAGGTTCCTCTCGCCGCGGGTGAGCCGGTCGATCCCATCGACCAAGGGGCTTCAC
CACCACGGTGAGGCGCCGGAAGCGGCCGGATATACCATCGCCGAGCTGGCGCGGCTTGCGAGAAGCGCCGTGCCC
GCCCAGCGATGTATGGCCTATCAGACGCTTGGCAGAATCCTATATCGGCTCGGACGGGGCGAGTGGGGGAAGACG
GAGGATGACCCCATCGCCATGGGCGTCTGGAGCTCGATCAAGCAGGGGAGGGTGCTTGAGAGCCTTTTCGAGGCG
GCCTCGGGTGAAGGCGGGCACCGGGGCAGTCGAGCATACGCCACAGAAGCCCTTTGGCTTTTCGACAAGGGCGGA
TGGAAGGAGAAGCACAAGGGACGGTGA
Transcript >Ophun1|6969
ATGGATCCGACGCTGCTTATAGGCGACATCGTCGAGCGAGATTCTTCGGACTCATCGAGCAAGCCAGTCGAGTTC
CGCGCGCCGAAAGCCACTGCCACGGGCTTTCCACGACACAGACATAGATGGCGGCCCAAGTCCGACGAGGCGAAC
AAGGCCCGACCTGCGTCGCCGCCCCAGGCCGCTGCAAGCTTCGACGAGACAGAAAGACGGCGTATAGACCATGAG
AATCGACAGAAACTCGCAAACATGACGCCGCAGGAGATTGCGCAGGCCCAGCAGGACATCATCAACGGCCTGAAT
CCTGCCTTAGTGCGACGACTCCTCCAGCGGGCCACCATAGACGACGACCCTACGCCCTCGCCCTTTGATACGCAG
GAAGCGCCGCCTGAGATACGGATTGAACCCCCAGAGACTACGTCGAATGTTCACGCCCCGGCGCATCGCCCGCCC
ACTCCCGAGACCAAGACCGCAAAAGCCCCCTACGATGAGGATCAGGCACCGGCACAAATACCCGCAGACCTGTTT
CCCATCACCAACCTGCCCAAGACGACGCATTTTCCAGCACCTCCAGCTCTTCCCGACCTGGACCCGTCTGAACCC
GATTTCCTGGCAACACTGCACGAAAAGTACTTCCCCAACCTGCCCGCAGACCCGAGCAAGCTCGCCTGGATGGCG
CCGGTGCCCACCCAGGACAGTCCAGCCGACAAGGATTCGCCGTACTATCCTCACCCCGAGATTGGCGTTTCGGCC
TTGCGATTCGACTTCCGCGGCAGGTTCCTCTCGCCGCGGGTGAGCCGGTCGATCCCATCGACCAAGGGGCTTCAC
CACCACGGTGAGGCGCCGGAAGCGGCCGGATATACCATCGCCGAGCTGGCGCGGCTTGCGAGAAGCGCCGTGCCC
GCCCAGCGATGTATGGCCTATCAGACGCTTGGCAGAATCCTATATCGGCTCGGACGGGGCGAGTGGGGGAAGACG
GAGGATGACCCCATCGCCATGGGCGTCTGGAGCTCGATCAAGCAGGGGAGGGTGCTTGAGAGCCTTTTCGAGGCG
GCCTCGGGTGAAGGCGGGCACCGGGGCAGTCGAGCATACGCCACAGAAGCCCTTTGGCTTTTCGACAAGGGCGGA
TGGAAGGAGAAGCACAAGGGACGGTGA
Gene >Ophun1|6969
ATGGATCCGACGCTGCTTATAGGCGACATCGTCGAGCGAGATTCTTCGGACTCATCGAGCAAGCCAGTCGAGTTC
CGCGCGCCGAAAGCCACTGCCACGGGCTTTCCACGACACAGACATAGATGGCGGCCCAAGTCCGACGAGGCGAAC
AAGGCCCGACCTGCGTCGCCGCCCCAGGCCGCTGCAAGCTTCGACGAGACAGAAAGACGGCGTATAGACCATGAG
AATCGACAGAAACTCGCAAACATGACGCCGCAGGAGATTGCGCAGGCCCAGCAGGACATCATCAACGGCCTGAAT
CCTGCCTTAGTGCGACGACTCCTCCAGCGGGCCACCATAGACGACGACCCTACGCCCTCGCCCTTTGATACGCAG
GAAGCGCCGCCTGAGATACGGATTGAACCCCCAGAGACTACGTCGAATGTTCACGCCCCGGCGCATCGCCCGCCC
ACTCCCGAGACCAAGACCGCAAAAGCCCCCTACGATGAGGATCAGGCACCGGCACAAATACCCGCAGACCTGTTT
CCCATCACCAACCTGCCCAAGACGACGCATTTTCCAGCACCTCCAGCTCTTCCCGACCTGGACCCGTCTGAACCC
GATTTCCTGGCAACACTGCACGAAAAGTACTTCCCCAACCTGCCCGCAGACCCGAGCAAGCTCGCCTGGATGGCG
CCGGTGCCCACCCAGGACAGTCCAGCCGACAAGGATTCGCCGTACTATCCTCACCCCGAGATTGGCGTTTCGGCC
TTGCGATTCGACTTCCGCGGCAGGTTCCTCTCGCCGCGGGTGAGCCGGTCGATCCCATCGACCAAGGGGCTTCAC
CACCACGGTGAGGCGCCGGAAGCGGCCGGATATACCATCGCCGAGCTGGCGCGGCTTGCGAGAAGCGCCGTGCCC
GCCCAGCGATGTATGGCCTATCAGACGCTTGGCAGAATCCTATATCGGCTCGGACGGGGCGAGTGGGGGAAGACG
GAGGATGACCCCATCGCCATGGGCGTCTGGAGCTCGATCAAGCAGGGGAGGGTGCTTGAGAGCCTTTTCGAGGCG
GCCTCGGGTGAAGGCGGGCACCGGGGCAGTCGAGCATACGCCACAGAAGCCCTTTGGCTTTTCGACAAGGGCGGA
TGGAAGGAGAAGCACAAGGGACGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail