Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6961
Gene name
LocationContig_812:817..1870
Strand-
Gene length (bp)1053
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07039 DUF1325 SGF29 tudor-like domain 1.5E-35 220 348

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USW9|SGF29_SCHPO SAGA-associated factor 29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf29 PE=1 SV=2 208 348 1.0E-17
sp|P25554|SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF29 PE=1 SV=2 221 346 2.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5646
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1254
Ophiocordyceps australis map64 (Brazil) OphauB2|7565
Ophiocordyceps camponoti-rufipedis Ophun1|6961 (this protein)
Ophiocordyceps kimflemingae Ophio5|4266
Ophiocordyceps subramaniannii Hirsu2|795

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6961
MSQRNRSGRGSNRNNGNNAPGEEAQIWEACKAQMADIVAGVNNENDSLSELVKLDKEVGTMDPDRVPTDAIKQME
QLCRKGVKFSEANITSLKSVTEQLKILRAVVVAKEQAESSATGTGKRAARDSAAAATAATASLYDFDGAGDSPVP
SPVAGGGAGGAAASGGGAGGGSSSSTRKQHGDRSSNRDSMPPKADSVEPQGPTASASGSNNSRSRVVFSKGDAVA
FKPKAPSGEPSSDWILGEVAAVMGEGKSRRYKVLDIEPDDQSKQKEYRSSASSMIAITPESQAGTLRDWEAGKVV
LALYPNTTTFYKAEVHSMDEDGRVNLKFEGENDSTTLQQVERRFVIEFRA*
Coding >Ophun1|6961
ATGTCTCAGCGCAACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAACAATGCGCCCGGCGAGGAGGCGCAG
ATATGGGAAGCGTGCAAGGCGCAGATGGCGGATATCGTCGCGGGCGTCAACAACGAGAACGACAGCCTCTCCGAG
CTCGTCAAGCTGGATAAAGAGGTCGGCACCATGGATCCGGACAGGGTGCCTACGGACGCTATCAAGCAGATGGAG
CAGCTGTGTCGCAAAGGCGTCAAGTTCTCCGAGGCCAACATTACGAGCCTCAAGTCGGTGACGGAGCAGCTCAAG
ATCCTGCGGGCCGTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCAACCGGGACGGGTAAGAGGGCGGCTCGG
GACAGCGCGGCGGCGGCGACGGCGGCGACGGCCTCGCTCTACGACTTTGACGGCGCGGGCGACTCGCCGGTGCCG
AGTCCCGTGGCTGGCGGCGGTGCGGGAGGAGCAGCAGCCTCGGGAGGAGGGGCGGGAGGAGGCTCGTCGTCGTCG
ACGCGCAAGCAACACGGCGATCGTTCCAGTAACCGGGACAGCATGCCGCCCAAGGCGGACAGCGTGGAGCCTCAG
GGACCGACGGCTTCGGCAAGCGGCAGCAACAACAGCCGGTCACGCGTCGTCTTCTCCAAGGGTGACGCAGTGGCA
TTCAAGCCCAAGGCGCCGAGCGGCGAGCCGTCATCAGACTGGATCCTAGGCGAGGTAGCGGCGGTGATGGGAGAG
GGCAAAAGCCGACGCTACAAGGTTCTCGACATCGAACCCGACGACCAGAGCAAGCAGAAGGAGTACCGGTCGAGC
GCGAGCAGCATGATTGCCATAACACCCGAGAGCCAGGCTGGGACGCTGCGCGACTGGGAGGCGGGCAAGGTGGTG
CTGGCATTGTATCCTAACACGACGACGTTTTACAAGGCTGAAGTGCACAGCATGGATGAGGATGGGCGGGTGAAT
CTCAAGTTTGAGGGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAGACGCTTTGTTATTGAGTTTCGGGCT
TGA
Transcript >Ophun1|6961
ATGTCTCAGCGCAACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAACAATGCGCCCGGCGAGGAGGCGCAG
ATATGGGAAGCGTGCAAGGCGCAGATGGCGGATATCGTCGCGGGCGTCAACAACGAGAACGACAGCCTCTCCGAG
CTCGTCAAGCTGGATAAAGAGGTCGGCACCATGGATCCGGACAGGGTGCCTACGGACGCTATCAAGCAGATGGAG
CAGCTGTGTCGCAAAGGCGTCAAGTTCTCCGAGGCCAACATTACGAGCCTCAAGTCGGTGACGGAGCAGCTCAAG
ATCCTGCGGGCCGTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCAACCGGGACGGGTAAGAGGGCGGCTCGG
GACAGCGCGGCGGCGGCGACGGCGGCGACGGCCTCGCTCTACGACTTTGACGGCGCGGGCGACTCGCCGGTGCCG
AGTCCCGTGGCTGGCGGCGGTGCGGGAGGAGCAGCAGCCTCGGGAGGAGGGGCGGGAGGAGGCTCGTCGTCGTCG
ACGCGCAAGCAACACGGCGATCGTTCCAGTAACCGGGACAGCATGCCGCCCAAGGCGGACAGCGTGGAGCCTCAG
GGACCGACGGCTTCGGCAAGCGGCAGCAACAACAGCCGGTCACGCGTCGTCTTCTCCAAGGGTGACGCAGTGGCA
TTCAAGCCCAAGGCGCCGAGCGGCGAGCCGTCATCAGACTGGATCCTAGGCGAGGTAGCGGCGGTGATGGGAGAG
GGCAAAAGCCGACGCTACAAGGTTCTCGACATCGAACCCGACGACCAGAGCAAGCAGAAGGAGTACCGGTCGAGC
GCGAGCAGCATGATTGCCATAACACCCGAGAGCCAGGCTGGGACGCTGCGCGACTGGGAGGCGGGCAAGGTGGTG
CTGGCATTGTATCCTAACACGACGACGTTTTACAAGGCTGAAGTGCACAGCATGGATGAGGATGGGCGGGTGAAT
CTCAAGTTTGAGGGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAGACGCTTTGTTATTGAGTTTCGGGCT
TGA
Gene >Ophun1|6961
ATGTCTCAGCGCAACCGCAGCGGCCGCGGGTCCAACCGTAACAACGGCAACAATGCGCCCGGCGAGGAGGCGCAG
ATATGGGAAGCGTGCAAGGCGCAGATGGCGGATATCGTCGCGGGCGTCAACAACGAGAACGACAGCCTCTCCGAG
CTCGTCAAGCTGGATAAAGAGGTCGGCACCATGGATCCGGACAGGGTGCCTACGGACGCTATCAAGCAGATGGAG
CAGCTGTGTCGCAAAGGCGTCAAGTTCTCCGAGGCCAACATTACGAGCCTCAAGTCGGTGACGGAGCAGCTCAAG
ATCCTGCGGGCCGTGGTGGTGGCCAAGGAGCAGGCCGAGTCGTCGGCAACCGGGACGGGTAAGAGGGCGGCTCGG
GACAGCGCGGCGGCGGCGACGGCGGCGACGGCCTCGCTCTACGACTTTGACGGCGCGGGCGACTCGCCGGTGCCG
AGTCCCGTGGCTGGCGGCGGTGCGGGAGGAGCAGCAGCCTCGGGAGGAGGGGCGGGAGGAGGCTCGTCGTCGTCG
ACGCGCAAGCAACACGGCGATCGTTCCAGTAACCGGGACAGCATGCCGCCCAAGGCGGACAGCGTGGAGCCTCAG
GGACCGACGGCTTCGGCAAGCGGCAGCAACAACAGCCGGTCACGCGTCGTCTTCTCCAAGGGTGACGCAGTGGCA
TTCAAGCCCAAGGCGCCGAGCGGCGAGCCGTCATCAGACTGGATCCTAGGCGAGGTAGCGGCGGTGATGGGAGAG
GGCAAAAGCCGACGCTACAAGGTTCTCGACATCGAACCCGACGACCAGAGCAAGCAGAAGGAGTACCGGTCGAGC
GCGAGCAGCATGATTGCCATAACACCCGAGAGCCAGGCTGGGACGCTGCGCGACTGGGAGGCGGGCAAGGTGGTG
CTGGCATTGTATCCTAACACGACGACGTTTTACAAGGCTGAAGTGCACAGCATGGATGAGGATGGGCGGGTGAAT
CTCAAGTTTGAGGGCGAGAACGACTCTACGACGTTGCAGCAGGTTGAGAGACGCTTTGTTATTGAGTTTCGGGCT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail