Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6956
Gene name
LocationContig_810:2522..3079
Strand+
Gene length (bp)557
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02269 TFIID-18kDa Transcription initiation factor IID, 18kD subunit 1.3E-17 19 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11747|TAF13_YEAST Transcription initiation factor TFIID subunit 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF13 PE=1 SV=2 8 102 8.0E-16
sp|O60076|TAF13_SCHPO Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf13 PE=3 SV=3 20 111 6.0E-15
sp|Q54CN8|TAF13_DICDI Transcription initiation factor TFIID subunit 13 OS=Dictyostelium discoideum GN=taf13 PE=3 SV=1 20 102 1.0E-08
sp|Q6NQH4|TAF13_ARATH Transcription initiation factor TFIID subunit 13 OS=Arabidopsis thaliana GN=TAF13 PE=1 SV=1 20 113 2.0E-07
sp|Q5R9W6|TAF13_PONAB Transcription initiation factor TFIID subunit 13 OS=Pongo abelii GN=TAF13 PE=2 SV=1 20 102 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11747|TAF13_YEAST Transcription initiation factor TFIID subunit 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF13 PE=1 SV=2 8 102 8.0E-16
sp|O60076|TAF13_SCHPO Transcription initiation factor TFIID subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf13 PE=3 SV=3 20 111 6.0E-15
sp|Q54CN8|TAF13_DICDI Transcription initiation factor TFIID subunit 13 OS=Dictyostelium discoideum GN=taf13 PE=3 SV=1 20 102 1.0E-08
sp|Q6NQH4|TAF13_ARATH Transcription initiation factor TFIID subunit 13 OS=Arabidopsis thaliana GN=TAF13 PE=1 SV=1 20 113 2.0E-07
sp|Q5R9W6|TAF13_PONAB Transcription initiation factor TFIID subunit 13 OS=Pongo abelii GN=TAF13 PE=2 SV=1 20 102 6.0E-07
sp|P61216|TAF13_MOUSE Transcription initiation factor TFIID subunit 13 OS=Mus musculus GN=Taf13 PE=2 SV=1 20 102 6.0E-07
sp|Q15543|TAF13_HUMAN Transcription initiation factor TFIID subunit 13 OS=Homo sapiens GN=TAF13 PE=1 SV=1 20 102 6.0E-07
sp|Q148M7|TAF13_BOVIN Transcription initiation factor TFIID subunit 13 OS=Bos taurus GN=TAF13 PE=2 SV=1 20 102 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006366 transcription by RNA polymerase II Yes
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006351 transcription, DNA-templated No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6956
MEPRARAGKNVGKMNFSHNELAQLLYAHGDVKIPLPETVRVLDEILTDFMQSIAFEATRAAHYSGRQKIKYEDFE
FAFRKNPAFLGKVQEVFEKQREIKKARDIIRDGEDEIIKGAADEEKKRAKAEDRALPARADEELGEADDDVNAEA
DAMGKKR*
Coding >Ophun1|6956
ATGGAGCCCCGAGCGCGGGCCGGCAAAAATGTCGGCAAGATGAACTTCTCTCACAATGAACTGGCGCAGCTTCTT
TACGCGCACGGCGACGTCAAGATTCCTCTGCCCGAGACGGTCCGCGTCCTGGACGAGATCCTCACCGACTTCATG
CAGTCCATCGCCTTCGAGGCCACCCGTGCCGCTCACTACTCGGGACGTCAGAAGATTAAGTACGAGGACTTTGAG
TTCGCCTTTCGCAAAAACCCGGCCTTCCTGGGCAAGGTGCAGGAAGTCTTTGAGAAGCAGCGAGAAATTAAGAAG
GCTCGCGATATCATACGCGATGGAGAGGATGAGATCATCAAGGGTGCAGCCGACGAGGAGAAGAAGCGCGCAAAG
GCCGAAGATAGAGCCCTGCCCGCTCGTGCGGATGAGGAGCTAGGCGAGGCCGACGACGATGTCAATGCCGAAGCC
GATGCAATGGGTAAGAAGCGCTGA
Transcript >Ophun1|6956
ATGGAGCCCCGAGCGCGGGCCGGCAAAAATGTCGGCAAGATGAACTTCTCTCACAATGAACTGGCGCAGCTTCTT
TACGCGCACGGCGACGTCAAGATTCCTCTGCCCGAGACGGTCCGCGTCCTGGACGAGATCCTCACCGACTTCATG
CAGTCCATCGCCTTCGAGGCCACCCGTGCCGCTCACTACTCGGGACGTCAGAAGATTAAGTACGAGGACTTTGAG
TTCGCCTTTCGCAAAAACCCGGCCTTCCTGGGCAAGGTGCAGGAAGTCTTTGAGAAGCAGCGAGAAATTAAGAAG
GCTCGCGATATCATACGCGATGGAGAGGATGAGATCATCAAGGGTGCAGCCGACGAGGAGAAGAAGCGCGCAAAG
GCCGAAGATAGAGCCCTGCCCGCTCGTGCGGATGAGGAGCTAGGCGAGGCCGACGACGATGTCAATGCCGAAGCC
GATGCAATGGGTAAGAAGCGCTGA
Gene >Ophun1|6956
ATGGAGCCCCGAGCGCGGGCCGGCAAAAATGTCGGCAAGATGAACTTCTCTCACAATGAACGTGCGTCGTCATCG
ATTCGCACTCCCAAATACCCTTTGGATTATCGCGTCAGACTCTGACACGTCTCTTTCCACCTCTTCTAGTGGCGC
AGCTTCTTTACGCGCACGGCGACGTCAAGATTCCTCTGCCCGAGACGGTCCGCGTCCTGGACGAGATCCTCACCG
ACTTCATGCAGTCCATCGCCTTCGAGGCCACCCGTGCCGCTCACTACTCGGGACGTCAGAAGATTAAGTACGAGG
ACTTTGAGTTCGCCTTTCGCAAAAACCCGGCCTTCCTGGGCAAGGTGCAGGAAGTCTTTGAGAAGCAGCGAGAAA
TTAAGAAGGCTCGCGATATCATACGCGATGGAGAGGATGAGATCATCAAGGGTGCAGCCGACGAGGAGAAGAAGC
GCGCAAAGGCCGAAGATAGAGCCCTGCCCGCTCGTGCGGATGAGGAGCTAGGCGAGGCCGACGACGATGTCAATG
CCGAAGCCGATGCAATGGGTAAGAAGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail