Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6954
Gene name
LocationContig_81:24905..40141
Strand+
Gene length (bp)15236
Transcript length (bp)14364
Coding sequence length (bp)14364
Protein length (aa) 4788

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.1E-68 61 441
PF00501 AMP-binding AMP-binding enzyme 2.3E-77 1090 1482
PF00501 AMP-binding AMP-binding enzyme 5.0E-78 2693 3087
PF00668 Condensation Condensation domain 8.1E-30 657 1063
PF00668 Condensation Condensation domain 3.0E-08 1718 1901
PF00668 Condensation Condensation domain 9.6E-33 2243 2657
PF00668 Condensation Condensation domain 2.2E-27 3336 3664
PF00668 Condensation Condensation domain 2.2E-21 3877 4272
PF00668 Condensation Condensation domain 7.7E-11 4513 4723
PF00550 PP-binding Phosphopantetheine attachment site 8.5E-06 556 614
PF00550 PP-binding Phosphopantetheine attachment site 3.8E-07 1616 1678
PF00550 PP-binding Phosphopantetheine attachment site 1.9E-10 2139 2203
PF00550 PP-binding Phosphopantetheine attachment site 4.9E-09 3224 3286
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-10 3774 3835
PF00550 PP-binding Phosphopantetheine attachment site 2.6E-09 4327 4389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2122 4267 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2116 4710 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 63 2591 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 60 2511 8.0E-180
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 63 2108 4.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2122 4267 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2116 4710 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 63 2591 0.0E+00
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 60 2511 8.0E-180
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 63 2108 4.0E-161
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 66 2017 2.0E-150
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 82 2072 4.0E-150
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 105 1899 4.0E-147
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 66 2074 2.0E-143
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 505 2611 4.0E-136
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 62 1678 5.0E-133
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 62 2184 9.0E-131
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 67 1896 6.0E-130
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 67 1877 4.0E-129
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 65 2089 9.0E-129
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 61 1883 2.0E-128
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 65 2026 1.0E-127
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2118 4179 1.0E-125
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2130 3725 5.0E-124
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 66 2020 8.0E-124
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 62 2183 2.0E-123
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 63 1994 5.0E-123
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 63 2008 1.0E-122
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 65 2021 8.0E-122
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 63 2187 1.0E-120
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 65 2022 2.0E-120
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 63 1971 3.0E-120
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 60 1857 1.0E-118
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 63 1941 3.0E-118
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2100 3725 4.0E-118
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 62 1699 9.0E-118
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 65 1678 2.0E-117
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 66 2027 4.0E-117
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 66 1905 4.0E-117
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 62 1862 5.0E-117
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 63 1679 7.0E-117
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 93 1862 2.0E-116
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 66 1945 3.0E-116
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 66 1945 5.0E-116
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 65 2022 3.0E-115
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 65 1777 8.0E-115
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 67 2022 9.0E-114
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 67 1682 1.0E-112
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 97 1657 1.0E-112
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 65 1756 1.0E-112
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 60 1857 4.0E-112
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 62 1862 4.0E-112
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 97 1867 1.0E-111
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 60 1662 2.0E-111
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 62 1902 6.0E-109
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 63 1581 1.0E-108
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 65 2183 5.0E-108
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 53 1905 3.0E-107
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 66 1689 4.0E-107
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 62 1581 1.0E-106
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 65 1699 1.0E-105
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 65 2183 8.0E-105
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 66 1870 2.0E-104
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 645 2023 1.0E-103
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 66 2006 1.0E-102
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 66 1673 2.0E-102
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 65 1583 4.0E-102
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 60 1661 2.0E-101
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2177 3660 3.0E-99
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2134 3647 4.0E-96
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2134 3668 2.0E-95
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 65 1581 1.0E-94
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 65 1020 2.0E-94
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 65 1768 3.0E-94
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 65 1768 5.0E-94
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1085 3079 1.0E-91
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2669 4246 5.0E-91
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2134 3502 3.0E-90
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2242 3844 4.0E-90
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2606 3727 1.0E-89
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 762 2021 1.0E-88
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 636 2402 4.0E-87
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2241 3848 9.0E-87
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 650 1902 2.0E-86
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 770 2022 1.0E-85
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2240 3848 1.0E-85
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2242 3663 5.0E-85
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 655 2136 1.0E-83
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2242 3663 2.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 769 2083 2.0E-83
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1083 2091 2.0E-83
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 651 2111 8.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 761 2022 9.0E-83
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 646 2002 1.0E-82
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2134 3281 2.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2682 3663 3.0E-82
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1085 2081 1.0E-81
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 650 2031 2.0E-80
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 753 1857 5.0E-79
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 63 1524 5.0E-79
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2137 3403 7.0E-79
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2242 3716 1.0E-78
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 651 2022 2.0E-78
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 769 2022 6.0E-78
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 650 2021 1.0E-77
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2119 3663 1.0E-77
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 650 2021 4.0E-77
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 651 2036 4.0E-77
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 761 1583 5.0E-77
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2130 3652 2.0E-76
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2134 3400 2.0E-76
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2242 3663 4.0E-76
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2134 3627 9.0E-76
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2242 3647 9.0E-76
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 63 1686 1.0E-75
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 523 1677 2.0E-75
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 744 2021 2.0E-75
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 97 948 1.0E-74
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2132 3494 1.0E-74
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 761 1583 1.0E-74
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2134 3881 1.0E-74
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 654 2183 1.0E-74
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 654 1859 1.0E-74
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 67 984 2.0E-74
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2618 3725 3.0E-74
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2134 3662 2.0E-73
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2241 3684 3.0E-73
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2134 3662 4.0E-73
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 765 2183 8.0E-73
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 546 2022 8.0E-73
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 769 2021 1.0E-72
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 606 2026 2.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2719 3672 2.0E-71
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1075 1896 2.0E-71
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2240 3647 3.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2240 3696 7.0E-71
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 67 793 8.0E-71
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2134 3699 8.0E-71
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2597 3725 1.0E-70
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 602 1581 2.0E-70
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2144 3265 3.0E-70
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2134 3521 4.0E-70
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2373 3646 4.0E-70
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2241 3668 4.0E-70
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2135 3284 5.0E-70
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2240 3296 6.0E-70
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2242 3663 1.0E-69
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2134 3817 3.0E-69
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2134 3521 4.0E-69
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1007 2026 5.0E-69
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2071 3645 1.0E-68
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 100 965 2.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2114 3294 2.0E-68
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2273 3495 2.0E-68
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 773 2026 2.0E-68
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 63 968 2.0E-68
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2240 3822 3.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2137 3843 5.0E-68
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1118 2102 5.0E-68
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2277 3663 2.0E-67
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2085 3663 4.0E-67
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2235 3403 4.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2134 3693 5.0E-67
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 65 794 7.0E-67
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2706 3650 2.0E-66
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2706 3650 3.0E-66
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2134 3610 3.0E-66
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2686 3650 3.0E-66
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2271 3675 5.0E-66
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2240 3663 8.0E-66
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2240 3663 8.0E-66
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1067 2021 1.0E-65
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1118 2031 2.0E-65
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2273 3286 2.0E-65
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 650 1680 2.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2134 3693 3.0E-65
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2656 3284 3.0E-65
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2241 3890 4.0E-65
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1929 3695 4.0E-65
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2134 3663 7.0E-65
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2114 3627 8.0E-65
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2273 3738 8.0E-65
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1118 2088 1.0E-64
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2241 3663 2.0E-64
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2188 3264 3.0E-64
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1118 2088 4.0E-64
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 775 1684 7.0E-64
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1118 1691 9.0E-64
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1118 1691 9.0E-64
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1118 2038 2.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2273 3685 2.0E-63
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 63 1062 2.0E-63
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1118 2088 4.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1089 1899 5.0E-63
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2150 3294 6.0E-63
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2622 3667 8.0E-63
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2136 3286 8.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2137 3479 2.0E-62
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2120 3647 2.0E-62
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2135 3671 6.0E-62
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2134 3395 1.0E-61
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 773 2022 1.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2155 3268 1.0E-61
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2273 3340 2.0E-61
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 753 2107 2.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2239 3262 3.0E-61
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2241 3295 3.0E-61
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2135 3671 3.0E-61
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2686 3650 3.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 62 631 5.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 64 793 9.0E-61
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 757 1710 9.0E-61
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2134 3298 2.0E-60
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 61 614 4.0E-60
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2492 3553 4.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2655 3316 4.0E-60
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2058 3296 5.0E-60
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 696 1677 6.0E-60
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1118 1859 7.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2655 3316 8.0E-60
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 696 1583 1.0E-59
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2134 3352 3.0E-59
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1085 1686 3.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2208 3284 4.0E-59
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2138 3262 4.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2686 3663 5.0E-59
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 63 620 5.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1027 1677 6.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2214 3663 7.0E-59
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 770 1583 9.0E-59
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2273 3284 1.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1022 1676 1.0E-58
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2232 3288 2.0E-58
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1010 1860 3.0E-58
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2279 3297 3.0E-58
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2134 3352 4.0E-58
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2267 3309 9.0E-58
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2137 3290 1.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2132 3281 2.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 755 1497 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 66 531 3.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 61 723 4.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2134 3325 6.0E-57
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2686 3613 8.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2136 3294 1.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 997 2184 1.0E-56
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2480 3728 1.0E-56
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1118 1869 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2658 3584 3.0E-56
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2686 3663 3.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2153 3268 4.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 63 791 4.0E-56
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1118 2006 7.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 62 964 8.0E-56
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2484 3401 1.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2613 3316 2.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 63 1075 3.0E-55
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 63 986 3.0E-55
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1118 1859 3.0E-55
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1114 2089 3.0E-55
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 768 2018 3.0E-55
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2239 3666 7.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2714 3292 7.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 63 976 2.0E-54
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 771 1681 2.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 63 614 2.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2164 3297 2.0E-54
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 63 986 3.0E-54
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 63 986 5.0E-54
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2630 3267 7.0E-54
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 97 791 1.0E-53
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 62 1077 1.0E-53
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1055 2002 1.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2686 3708 2.0E-53
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 63 620 2.0E-53
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2716 3677 3.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 62 791 4.0E-53
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 770 1680 6.0E-53
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 62 614 1.0E-52
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 63 613 1.0E-52
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2686 3708 1.0E-52
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 63 984 1.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 61 831 2.0E-52
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2719 3299 2.0E-52
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 63 531 2.0E-52
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 63 620 3.0E-52
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 57 935 4.0E-52
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2718 3645 4.0E-52
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 64 791 9.0E-52
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2131 3285 1.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1117 1684 1.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 63 554 2.0E-51
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2664 3663 3.0E-51
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 67 933 5.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2719 3186 6.0E-51
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 57 794 8.0E-51
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2733 3659 1.0E-50
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 63 965 3.0E-50
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 65 566 1.0E-49
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2687 3132 1.0E-49
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 65 631 1.0E-49
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 61 620 3.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 62 669 5.0E-49
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2134 3300 1.0E-48
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2686 3724 1.0E-48
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1609 2537 3.0E-48
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 62 650 4.0E-48
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 65 531 1.0E-47
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 62 531 2.0E-47
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2134 3486 2.0E-47
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2714 3783 4.0E-47
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 62 531 2.0E-46
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 65 619 2.0E-46
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2706 3400 3.0E-46
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 62 527 4.0E-46
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 63 985 8.0E-46
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2717 3316 9.0E-46
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2718 3316 4.0E-45
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2718 3316 7.0E-45
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1118 1583 2.0E-44
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 63 618 4.0E-44
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2095 3265 1.0E-43
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2095 3265 2.0E-43
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1118 2021 3.0E-43
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2126 3190 3.0E-43
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 65 628 3.0E-43
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 61 610 3.0E-43
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 61 610 3.0E-43
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2686 3663 5.0E-43
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3767 4708 6.0E-43
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2134 3131 2.0E-42
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1101 1688 3.0E-42
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2733 3281 3.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 66 617 6.0E-42
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2095 3265 7.0E-42
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 66 460 2.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 66 617 3.0E-41
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2717 3190 3.0E-41
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 655 1588 8.0E-41
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 66 505 9.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2478 3190 9.0E-41
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2717 3192 9.0E-41
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 553 1469 1.0E-40
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 98 638 2.0E-40
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 64 952 6.0E-40
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2686 3191 6.0E-40
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1119 1680 8.0E-40
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 61 831 9.0E-40
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2697 3190 1.0E-39
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2697 3190 1.0E-39
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2697 3190 1.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 93 614 1.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 93 614 1.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 93 614 1.0E-39
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 994 1969 2.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2686 3290 3.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2686 3290 3.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2686 3290 4.0E-39
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2697 3190 4.0E-39
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2743 3190 4.0E-39
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2743 3190 4.0E-39
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2676 3190 4.0E-39
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2697 3190 4.0E-39
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2697 3190 4.0E-39
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2697 3190 4.0E-39
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2697 3190 4.0E-39
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 104 795 5.0E-39
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1118 1582 5.0E-39
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2697 3190 7.0E-39
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2697 3190 1.0E-38
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2697 3190 1.0E-38
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 765 1706 1.0E-38
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2703 3190 1.0E-38
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2719 3615 2.0E-38
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1087 1691 2.0E-38
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1087 1686 4.0E-38
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1087 1691 5.0E-38
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2738 3263 5.0E-38
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2676 3190 6.0E-38
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2717 3192 9.0E-38
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2717 3192 1.0E-37
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1118 1583 2.0E-37
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2717 3192 3.0E-37
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2717 3192 3.0E-37
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 66 537 4.0E-37
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2717 3192 4.0E-37
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2743 3190 5.0E-37
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2717 3192 7.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2717 3192 1.0E-36
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 63 617 3.0E-36
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2697 3190 3.0E-36
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 66 533 4.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2717 3191 4.0E-36
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 65 627 5.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1118 1583 7.0E-36
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 63 533 9.0E-36
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3791 4504 1.0E-35
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 66 533 2.0E-35
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 66 533 5.0E-35
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 66 533 6.0E-35
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 63 533 7.0E-35
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 63 533 7.0E-35
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 63 533 7.0E-35
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 66 533 8.0E-35
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1119 1581 9.0E-35
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 63 533 1.0E-34
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 63 533 1.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 63 533 2.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 63 533 2.0E-34
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1119 1581 2.0E-34
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 61 803 3.0E-34
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 63 533 3.0E-34
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 63 533 3.0E-34
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 63 533 3.0E-34
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 63 533 3.0E-34
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 63 533 3.0E-34
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 63 533 4.0E-34
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2757 3190 4.0E-34
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2757 3190 4.0E-34
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2757 3190 4.0E-34
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2757 3190 4.0E-34
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2757 3190 5.0E-34
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2757 3190 5.0E-34
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2757 3190 6.0E-34
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2757 3190 6.0E-34
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2757 3190 6.0E-34
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2757 3190 6.0E-34
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2757 3190 6.0E-34
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 63 533 8.0E-34
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1119 1581 9.0E-34
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2757 3190 1.0E-33
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1119 1581 2.0E-33
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1119 1581 2.0E-33
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1119 1581 2.0E-33
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1119 1581 3.0E-33
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1119 1581 3.0E-33
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1119 1581 3.0E-33
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1119 1581 3.0E-33
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1119 1581 3.0E-33
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1119 1581 3.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1118 1583 3.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2719 3190 3.0E-33
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 98 808 4.0E-33
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2697 3190 4.0E-33
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2690 3190 5.0E-33
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 98 620 5.0E-33
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 98 867 6.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2719 3190 6.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 66 531 1.0E-32
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1119 1581 1.0E-32
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1119 1581 1.0E-32
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1119 1581 1.0E-32
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2742 3197 1.0E-32
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2697 3190 1.0E-32
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1118 1652 3.0E-32
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1118 1652 3.0E-32
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 60 531 3.0E-32
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 63 533 3.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1116 1581 4.0E-32
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 66 531 5.0E-32
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 66 531 6.0E-32
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 60 531 8.0E-32
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2697 3190 1.0E-31
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2697 3190 1.0E-31
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2697 3190 1.0E-31
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2697 3190 1.0E-31
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2697 3190 1.0E-31
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2697 3190 1.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2698 3190 3.0E-31
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2757 3190 3.0E-31
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1118 1582 5.0E-31
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2616 3262 7.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 61 475 9.0E-31
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 63 567 9.0E-31
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1089 1722 9.0E-31
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2757 3190 2.0E-30
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2757 3190 2.0E-30
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2757 3190 2.0E-30
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2757 3190 2.0E-30
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2757 3190 3.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2757 3190 4.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2757 3190 5.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2757 3190 5.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2757 3190 5.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2757 3190 5.0E-30
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2686 3190 7.0E-30
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 60 620 9.0E-30
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1119 1581 1.0E-29
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 65 537 2.0E-29
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1085 1581 3.0E-29
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1085 1581 3.0E-29
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1085 1581 3.0E-29
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1085 1581 4.0E-29
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1085 1581 4.0E-29
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1118 1582 5.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 99 533 5.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 99 533 6.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 99 533 6.0E-29
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 66 539 9.0E-29
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1085 1581 1.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 60 531 1.0E-28
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2678 3267 2.0E-28
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2271 3264 2.0E-28
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1085 1581 2.0E-28
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1085 1581 2.0E-28
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2678 3267 3.0E-28
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1085 1581 3.0E-28
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1085 1581 3.0E-28
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1085 1581 3.0E-28
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1085 1581 3.0E-28
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1085 1581 3.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3764 4157 4.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 60 531 4.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1118 1585 4.0E-28
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2612 3288 4.0E-28
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1160 1581 4.0E-28
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1118 1582 5.0E-28
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 855 1578 5.0E-28
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1085 1581 6.0E-28
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1118 1582 6.0E-28
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1106 1583 7.0E-28
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1118 1582 1.0E-27
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 60 531 1.0E-27
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2716 3190 1.0E-27
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2760 3130 1.0E-27
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1139 1680 2.0E-27
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1106 1583 2.0E-27
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1160 1581 2.0E-27
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1160 1581 2.0E-27
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1160 1581 2.0E-27
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1160 1581 2.0E-27
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1089 1724 2.0E-27
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1114 1581 3.0E-27
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 99 533 3.0E-27
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1106 1583 3.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1119 1581 3.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1119 1581 3.0E-27
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1085 1581 4.0E-27
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 107 532 5.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1119 1581 5.0E-27
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 726 1717 6.0E-27
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1118 1583 1.0E-26
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1160 1581 1.0E-26
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1160 1581 1.0E-26
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 62 794 2.0E-26
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 67 537 2.0E-26
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 67 537 2.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3084 3645 3.0E-26
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 99 537 3.0E-26
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 99 537 3.0E-26
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 99 537 3.0E-26
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3789 4562 4.0E-26
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1106 1583 7.0E-26
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1106 1583 7.0E-26
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1106 1583 7.0E-26
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1106 1583 7.0E-26
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1106 1583 7.0E-26
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1106 1583 7.0E-26
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 67 527 7.0E-26
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 67 527 7.0E-26
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 67 527 7.0E-26
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 67 527 7.0E-26
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1089 1677 1.0E-25
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 67 527 2.0E-25
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2716 3265 2.0E-25
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2601 3300 2.0E-25
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1143 1684 2.0E-25
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2680 3100 2.0E-25
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2198 3092 3.0E-25
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 122 476 4.0E-25
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 67 527 5.0E-25
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 67 527 5.0E-25
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2671 3299 5.0E-25
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 916 1737 6.0E-25
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 916 1737 8.0E-25
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1118 1583 8.0E-25
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1519 1969 1.0E-24
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 916 1737 1.0E-24
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3173 3657 3.0E-24
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3783 4270 3.0E-24
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 67 527 3.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3165 3820 6.0E-24
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2671 3289 7.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 105 531 9.0E-24
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3774 4278 1.0E-23
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 105 531 1.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 105 531 1.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 105 531 1.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 105 531 1.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 105 531 1.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 105 531 1.0E-23
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1027 1680 1.0E-23
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 114 463 2.0E-23
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3789 4207 3.0E-23
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 66 531 3.0E-23
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1159 1583 5.0E-23
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1118 1583 6.0E-23
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3789 4272 9.0E-23
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 105 531 1.0E-22
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3794 4183 6.0E-22
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 65 593 7.0E-22
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 105 531 1.0E-21
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1096 1657 2.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1115 1583 3.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 103 534 6.0E-21
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3795 4208 8.0E-21
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 63 440 9.0E-21
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1161 1524 1.0E-20
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1090 1508 1.0E-20
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3768 4204 2.0E-20
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 1109 1583 4.0E-20
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2696 3192 4.0E-20
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2069 2581 1.0E-19
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2716 3191 1.0E-19
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1142 1587 1.0E-19
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3795 4208 2.0E-19
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2743 3276 2.0E-19
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3795 4208 3.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1084 1585 3.0E-19
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 66 531 4.0E-19
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1116 1582 2.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4340 4777 3.0E-18
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3873 4269 3.0E-18
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1119 1583 3.0E-18
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1240 1583 3.0E-18
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2134 2514 4.0E-18
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 65 532 4.0E-18
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2716 3191 4.0E-18
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 2716 3191 7.0E-18
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1170 1581 8.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 383 985 9.0E-18
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2678 3191 9.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3359 3663 2.0E-17
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1119 1583 2.0E-17
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2716 3191 2.0E-17
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1101 1596 2.0E-17
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1119 1583 3.0E-17
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3022 3663 4.0E-17
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2716 3191 4.0E-17
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2686 3194 4.0E-17
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2716 3191 4.0E-17
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3789 4154 6.0E-17
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2716 3191 6.0E-17
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2716 3191 8.0E-17
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2716 3191 8.0E-17
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2694 3185 1.0E-16
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2716 3191 1.0E-16
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2716 3191 1.0E-16
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 2716 3191 1.0E-16
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 2716 3191 1.0E-16
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 1117 1583 1.0E-16
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1119 1583 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3780 4258 2.0E-16
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3869 4193 2.0E-16
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2716 3191 2.0E-16
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2716 3191 2.0E-16
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 2716 3191 2.0E-16
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2716 3191 2.0E-16
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1238 1599 2.0E-16
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2716 3191 3.0E-16
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2716 3191 3.0E-16
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2716 3191 3.0E-16
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2716 3191 3.0E-16
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1238 1579 3.0E-16
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1119 1583 4.0E-16
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2716 3191 4.0E-16
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 2716 3191 4.0E-16
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1119 1583 5.0E-16
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1080 1583 5.0E-16
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2667 3190 5.0E-16
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2716 3191 6.0E-16
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 1232 1583 7.0E-16
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2716 3191 9.0E-16
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1114 1582 9.0E-16
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2716 3191 9.0E-16
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2826 3663 1.0E-15
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2716 3191 1.0E-15
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1118 1588 1.0E-15
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2716 3191 1.0E-15
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2719 3196 1.0E-15
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2716 3191 1.0E-15
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2716 3191 1.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3841 4269 2.0E-15
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2833 3202 2.0E-15
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1080 1583 2.0E-15
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2716 3191 2.0E-15
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2716 3191 2.0E-15
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2716 3191 2.0E-15
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1119 1582 2.0E-15
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1238 1590 2.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3873 4269 4.0E-15
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2716 3191 4.0E-15
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3340 3663 5.0E-15
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1119 1583 5.0E-15
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3733 4199 6.0E-15
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1101 1666 6.0E-15
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2716 3191 1.0E-14
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2716 3191 1.0E-14
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1716 2022 2.0E-14
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2716 3191 2.0E-14
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2716 3191 2.0E-14
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2716 3100 2.0E-14
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2716 3191 2.0E-14
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2716 3191 2.0E-14
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2716 3191 2.0E-14
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1118 1583 2.0E-14
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1118 1583 2.0E-14
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1236 1495 2.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 190 593 3.0E-14
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2716 3191 3.0E-14
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 1117 1591 3.0E-14
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2717 3191 3.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1715 2040 4.0E-14
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 1089 1587 4.0E-14
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1405 1581 5.0E-14
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 1147 1586 5.0E-14
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1240 1588 5.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3332 3663 6.0E-14
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 2686 3194 6.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 190 543 7.0E-14
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1118 1588 7.0E-14
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1119 1583 8.0E-14
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3798 4272 1.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3850 4277 1.0E-13
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3333 3663 1.0E-13
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 98 533 1.0E-13
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 57 526 1.0E-13
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1118 1588 1.0E-13
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 1117 1591 1.0E-13
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 1093 1591 1.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 579 931 2.0E-13
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3227 3666 2.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3866 4270 2.0E-13
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3873 4270 2.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3867 4233 2.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1416 2021 2.0E-13
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 97 594 2.0E-13
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1119 1585 2.0E-13
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3331 3663 3.0E-13
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3333 3663 3.0E-13
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1118 1588 3.0E-13
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2718 3138 3.0E-13
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 1238 1586 3.0E-13
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3857 4287 4.0E-13
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2718 3136 4.0E-13
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1118 1588 4.0E-13
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1077 1586 4.0E-13
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1111 1585 4.0E-13
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1118 1588 4.0E-13
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1118 1588 4.0E-13
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 1115 1588 4.0E-13
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1111 1587 4.0E-13
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1119 1583 5.0E-13
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 1238 1586 5.0E-13
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1118 1588 5.0E-13
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1235 1583 6.0E-13
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 186 531 7.0E-13
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 57 533 7.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2134 2532 8.0E-13
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 67 535 8.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2840 3139 8.0E-13
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1238 1587 8.0E-13
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 1238 1587 9.0E-13
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1216 1581 9.0E-13
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1238 1583 9.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1640 2022 1.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 147 537 1.0E-12
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1118 1588 1.0E-12
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 1093 1591 1.0E-12
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 1129 1588 1.0E-12
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 1118 1583 1.0E-12
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 552 967 2.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3233 3651 2.0E-12
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3781 4157 2.0E-12
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 65 555 2.0E-12
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 1093 1598 2.0E-12
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1199 1581 2.0E-12
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 1208 1551 2.0E-12
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 1119 1588 2.0E-12
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2686 3194 2.0E-12
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3795 4266 3.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2717 3192 3.0E-12
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 1119 1583 3.0E-12
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1236 1583 3.0E-12
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1118 1588 3.0E-12
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1238 1586 4.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 61 532 4.0E-12
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 61 534 4.0E-12
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1118 1585 4.0E-12
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 1118 1625 4.0E-12
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3873 4200 5.0E-12
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2717 3191 5.0E-12
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1118 1588 5.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 66 532 5.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 66 532 5.0E-12
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 1093 1591 7.0E-12
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1236 1583 7.0E-12
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 1110 1582 7.0E-12
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1240 1585 8.0E-12
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 1093 1606 9.0E-12
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1118 1585 9.0E-12
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 1119 1589 9.0E-12
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1117 1583 9.0E-12
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1114 1585 1.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2717 3100 2.0E-11
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2831 3197 2.0E-11
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2841 3195 2.0E-11
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1235 1583 2.0E-11
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1235 1583 2.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1232 1583 2.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 66 532 2.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1232 1583 2.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 66 532 2.0E-11
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1236 1583 2.0E-11
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 61 539 2.0E-11
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 1118 1583 2.0E-11
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1108 1582 2.0E-11
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 1101 1578 2.0E-11
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1118 1582 2.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 530 1074 3.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 59 539 3.0E-11
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2717 3191 3.0E-11
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2841 3191 3.0E-11
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 66 532 3.0E-11
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3774 4319 4.0E-11
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3331 3663 4.0E-11
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1090 2105 4.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2839 3191 4.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 1118 1586 4.0E-11
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2716 3091 5.0E-11
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 65 546 5.0E-11
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2694 3191 6.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2218 2524 7.0E-11
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1118 1588 7.0E-11
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 1088 1583 7.0E-11
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 58 528 8.0E-11
sp|B2HIL4|FAA29_MYCMM Long-chain-fatty-acid--AMP ligase FadD29 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD29 PE=3 SV=1 1093 1583 8.0E-11
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2717 3196 9.0E-11
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2717 3196 9.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2717 3113 9.0E-11
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2134 2529 1.0E-10
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2717 3191 1.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2652 3100 1.0E-10
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2678 3191 1.0E-10
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2792 3113 1.0E-10
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 1217 1591 1.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3871 4191 2.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 1236 1579 2.0E-10
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1118 1582 2.0E-10
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2718 3130 2.0E-10
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1118 1581 2.0E-10
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 62 534 2.0E-10
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 2717 3192 2.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 1140 1583 2.0E-10
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2731 3202 2.0E-10
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 1097 1597 2.0E-10
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 1118 1589 2.0E-10
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3853 4191 3.0E-10
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 67 535 3.0E-10
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 63 540 3.0E-10
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1118 1583 3.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2840 3139 3.0E-10
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2841 3195 3.0E-10
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1235 1583 3.0E-10
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 191 532 3.0E-10
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1240 1585 3.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1236 1581 3.0E-10
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 93 534 4.0E-10
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2684 3190 4.0E-10
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2806 3113 4.0E-10
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 1235 1583 4.0E-10
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1738 2059 5.0E-10
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2713 3113 5.0E-10
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 2678 3191 5.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3872 4232 6.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3333 3607 6.0E-10
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3242 3651 6.0E-10
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2841 3195 6.0E-10
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2714 3194 6.0E-10
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1109 1581 6.0E-10
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1430 1591 7.0E-10
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 1118 1606 7.0E-10
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2841 3195 9.0E-10
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 1430 1591 9.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4326 4554 1.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3333 3647 1.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 4303 4715 1.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2807 3134 1.0E-09
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1113 1584 1.0E-09
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 1111 1587 1.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2806 3144 1.0E-09
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 1097 1619 1.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1119 1585 1.0E-09
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2738 3194 1.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1118 1582 1.0E-09
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 193 531 1.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3850 4277 2.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1717 2019 2.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2134 2581 2.0E-09
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 98 528 2.0E-09
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2836 3190 2.0E-09
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2830 3196 2.0E-09
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1118 1583 2.0E-09
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2678 3130 2.0E-09
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 1129 1591 2.0E-09
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 2819 3190 2.0E-09
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2819 3190 2.0E-09
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 2679 3101 2.0E-09
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1118 1588 2.0E-09
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2716 3192 2.0E-09
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2836 3130 2.0E-09
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 1114 1591 2.0E-09
sp|P9WQ49|FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD21 PE=1 SV=1 63 475 2.0E-09
sp|P9WQ48|FAD21_MYCTO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD21 PE=3 SV=1 63 475 2.0E-09
sp|P63524|FAD21_MYCBO Putative fatty-acid--CoA ligase fadD21 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD21 PE=3 SV=1 63 475 2.0E-09
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3873 4209 3.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3795 4160 3.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 61 533 3.0E-09
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2742 3191 3.0E-09
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2717 3100 3.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 67 534 3.0E-09
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 189 532 3.0E-09
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 58 477 3.0E-09
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1097 1585 3.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1097 1585 3.0E-09
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 1229 1597 3.0E-09
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 189 532 4.0E-09
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1105 1585 4.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1119 1585 4.0E-09
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 1229 1608 4.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3872 4203 5.0E-09
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2717 3101 5.0E-09
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 1198 1603 5.0E-09
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 1229 1608 5.0E-09
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 1229 1608 5.0E-09
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3875 4267 6.0E-09
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2714 3190 7.0E-09
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 2819 3190 7.0E-09
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 1226 1582 7.0E-09
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 1240 1588 8.0E-09
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 2716 3191 9.0E-09
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 1118 1597 9.0E-09
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 186 533 9.0E-09
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3855 4233 1.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3789 4158 1.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3875 4191 1.0E-08
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 2717 3191 1.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2717 3101 1.0E-08
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2836 3144 1.0E-08
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 2807 3190 1.0E-08
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 1118 1583 1.0E-08
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 1118 1585 1.0E-08
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 1101 1600 1.0E-08
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 1101 1600 1.0E-08
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 1118 1596 1.0E-08
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 1101 1600 1.0E-08
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 1101 1600 1.0E-08
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 1101 1600 1.0E-08
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 1101 1600 1.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1116 1585 1.0E-08
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 1118 1596 1.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2134 2656 2.0E-08
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2810 3130 2.0E-08
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2841 3195 2.0E-08
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2719 3191 2.0E-08
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2719 3191 2.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2716 3130 2.0E-08
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2719 3191 2.0E-08
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 188 549 2.0E-08
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 1112 1586 2.0E-08
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 1076 1583 2.0E-08
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1118 1579 2.0E-08
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 1431 1597 2.0E-08
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2135 2528 3.0E-08
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2135 2528 3.0E-08
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 1118 1583 3.0E-08
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1098 1581 3.0E-08
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 2819 3190 3.0E-08
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1117 1603 3.0E-08
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 1118 1608 4.0E-08
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 1431 1606 4.0E-08
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 2684 3091 4.0E-08
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 66 532 5.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 2741 3190 5.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 1118 1575 5.0E-08
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 1237 1583 5.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2738 3197 6.0E-08
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 61 533 7.0E-08
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 1431 1583 7.0E-08
sp|Q02278|FAA28_MYCBO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD28 PE=3 SV=2 98 441 7.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 185 533 7.0E-08
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1227 1586 7.0E-08
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2686 3197 7.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4309 4597 8.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3873 4184 8.0E-08
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2839 3144 8.0E-08
sp|P9WQ59|FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD28 PE=1 SV=1 98 441 8.0E-08
sp|P9WQ58|FAA28_MYCTO Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD28 PE=3 SV=1 98 441 8.0E-08
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 1431 1608 8.0E-08
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 1229 1587 9.0E-08
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3744 4232 1.0E-07
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3889 4208 1.0E-07
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2719 3191 1.0E-07
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 93 459 1.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1237 1591 1.0E-07
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 2737 3184 1.0E-07
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 1229 1587 1.0E-07
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 1229 1587 1.0E-07
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 1431 1606 1.0E-07
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 1118 1596 1.0E-07
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 1431 1606 1.0E-07
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 2716 3190 1.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 646 935 2.0E-07
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 2716 3191 2.0E-07
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2717 3100 2.0E-07
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 186 533 2.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2738 3197 2.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2835 3136 2.0E-07
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 2718 3043 2.0E-07
sp|A1RIK1|ACSA_SHESW Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 1072 1583 2.0E-07
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 1116 1588 2.0E-07
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 1431 1606 2.0E-07
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 1431 1606 2.0E-07
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 1231 1590 2.0E-07
sp|A4Y7Y7|ACSA_SHEPC Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 1118 1583 2.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1119 1587 2.0E-07
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 1432 1597 2.0E-07
sp|Q8EDK3|ACSA_SHEON Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 1098 1583 2.0E-07
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 1231 1589 2.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3869 4219 3.0E-07
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2841 3138 3.0E-07
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 1236 1581 3.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 154 534 3.0E-07
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 1237 1583 3.0E-07
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 1237 1597 3.0E-07
sp|B9JV43|ACSA_AGRVS Acetyl-coenzyme A synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=acsA PE=3 SV=1 1431 1608 3.0E-07
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 1116 1588 3.0E-07
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3998 4161 4.0E-07
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 1431 1583 4.0E-07
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 1432 1597 4.0E-07
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 188 549 4.0E-07
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 2833 3113 4.0E-07
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4326 4697 5.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2134 2541 5.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3912 4234 5.0E-07
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 103 464 5.0E-07
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 66 473 5.0E-07
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 2833 3113 5.0E-07
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 1471 1603 5.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2738 3197 6.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 167 531 6.0E-07
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1120 1588 6.0E-07
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 188 532 6.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 2833 3201 6.0E-07
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 1431 1606 6.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2134 2402 7.0E-07
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2947 3201 7.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1234 1495 7.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1233 1581 7.0E-07
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 1072 1583 7.0E-07
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 1431 1606 7.0E-07
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4326 4697 8.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2738 3197 8.0E-07
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1367 1582 8.0E-07
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 2824 3201 8.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3876 4277 9.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 58 459 9.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3787 4186 1.0E-06
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 93 459 1.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2738 3197 1.0E-06
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 1118 1608 1.0E-06
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 1432 1608 1.0E-06
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 1229 1591 1.0E-06
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 1432 1608 1.0E-06
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 57 549 1.0E-06
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 1432 1583 1.0E-06
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 1072 1583 1.0E-06
sp|A0KY83|ACSA_SHESA Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 1072 1583 1.0E-06
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3787 4188 2.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3148 3406 2.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2738 3197 2.0E-06
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2738 3197 2.0E-06
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 2718 3043 2.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 187 544 2.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 187 544 2.0E-06
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 1228 1582 2.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 1231 1589 2.0E-06
sp|Q4FVA1|ACSA_PSYA2 Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 2719 3105 2.0E-06
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 1231 1591 2.0E-06
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 1231 1591 2.0E-06
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 1231 1591 2.0E-06
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 1431 1583 2.0E-06
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 2833 3193 2.0E-06
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 67 574 2.0E-06
sp|A4YGR1|HPCAS_METS5 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 1433 1582 2.0E-06
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 2719 3136 2.0E-06
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 93 536 3.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2738 3197 3.0E-06
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1236 1581 3.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2840 3109 3.0E-06
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 2716 3131 3.0E-06
sp|C3MAS0|ACSA_RHISN Acetyl-coenzyme A synthetase OS=Rhizobium sp. (strain NGR234) GN=acsA PE=3 SV=1 1401 1597 3.0E-06
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 1432 1597 3.0E-06
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1228 1597 3.0E-06
sp|Q92KX2|ACSA_RHIME Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 1432 1608 3.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 187 534 3.0E-06
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3787 4278 4.0E-06
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 176 526 4.0E-06
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 2719 3137 4.0E-06
sp|P37418|MENE_SALTY 2-succinylbenzoate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menE PE=3 SV=2 1118 1507 4.0E-06
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 1182 1577 4.0E-06
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 1182 1577 4.0E-06
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 1182 1577 4.0E-06
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 1182 1577 4.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 187 533 5.0E-06
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 1231 1591 5.0E-06
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1228 1587 5.0E-06
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 4318 4548 6.0E-06
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3912 4266 7.0E-06
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2841 3200 7.0E-06
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 2837 3185 7.0E-06
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 2837 3185 7.0E-06
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 2837 3185 7.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2738 3197 8.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2738 3197 8.0E-06
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 1182 1577 8.0E-06
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 1182 1577 8.0E-06
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 1158 1263 9.0E-06
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 1182 1577 9.0E-06
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 1182 1577 9.0E-06
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2840 3109 9.0E-06
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 137 501 9.0E-06
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 1315 1582 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6954
MPASDSIFRIKQLIVSMAASVGHASHGQCDWTADPFMVHGVMLLLLATLSLLASPLHLDRNGNGSFTYREFHEAA
AAIASLLTDAIRSPERSRSSFIVPVLVPQSSLLCISLLAVLKAGGAFCPLNFDSPRERIRFIVKDVSATVVLVTR
ALAHLVPVEDVEKVIVVDDFELGDPSLPTIDYLESAPEDLAYVMYTSGSTGTPKGVCISHDAVTQALLAHDRHIP
AFSRFLQFAAPTFDVSVFEIFFPLFRGSTLVTASRDELLDDLPAVLRRTKVDACELTPTVAASLLRRRQNAPALK
LLLTIGEMLTLPVVEEFGGSETRPSMLWAMYGPTEATIHCTLQAALPSNSPVRNIGIPLDTVSCFVVDARVSAQG
GSDVRVLPRGQIGELAVGGYQLASGYLNRPEQTASAFITTPYGRLYLTGDRARMTPDGMLECLGRLTGGQLKLRG
QRIETGEVEQSALRASGCHGAVAAVIDANLVLFCAVDPGTSEDDIATCCKSWLPRFMVPGEIVLMAEFPCLPSGK
VDKPKLKSLHQEQKSTEPSEYDENLLAEEHEVVRVISSVLGRRVNRQMPLPLAGVDSLSAIKLASALRVSGFRME
VSDLLSLKTVADLCCQIRKSPMVKPSNQQPCVSILADLDTILAQHPGLNLKKENINDVISCTPLQTALLAETARD
PLLYCNQVEFEVAPGFTIQEVSAAICRVAADNEALRSGFVEARGGYAAIVFRTFGTDDNLRVVSHFDESFSFKEP
GDFLRPFRVQIRGLDVRLRVLFQVHHAVYDGWSMDLILSDLSALLRRQPLSPRPQFREVLRHHLRDSKDADEELA
MKFWGEYLAGWNKSSFPKLAARLQMSNVIKKTSCTFQILPDSVRKLAGERAIGAQVLFQASLALLWSGIAGDQDL
VLGSVTSGRTIPVDQIEEILGPCFASLPVRIDLSDMVSGKDLLTSIQASNRAMMQHCTLPLSGIRTLAGLQPAES
LYDVLLVYQESLESLNRKDWLFAEVNHLDRLETKLLLEIQPHETFYSIHATYHSSFFAPGLVDCLLQQLEDVTRM
LLESPDAGLQSIRSAAPGNSVHNIAVQPFHGVPDLAAQFEATAAAIPTATALCFCESLASSGPRTICMSYEELNR
AANRVARYLRSQAITVGEVLAVLMQKSPAFYTVVLGIQKAGCAYLPILPQTPEARIRTILEQARVEHCLVDNSSI
SSSLLKGVQIHDMERIELQQYSSKNQDIPYNASRLAYVVYTSGTTGVPKGVAVTQENIVSNITVLQSTYPTPKTS
EPRLLQACSQAFDVSVFEIFFAWHAGMCLCAAPNDVLFQDLERFMRLLKISHLSLTPTLASLIEPANVPEVEFLV
TAGEPMTMAVLDRWHDRLWQGYGPSETTNICSVKHMARGDNIEHLGWALPNTSSIVMRPGAANTVPVGWVGELCF
GGHQVARGYLNDHRLTREKFLYDPTYGRIYRSGDLGRMLPDGSLVILGRLDDQIKLRGQRIAAGEINSIITSTGL
ATTAVTISARRRTDAPEQLVSFFVTYGTGSEYSTLDVSPEVNRHLFAYLQSRLPPYMVPSYLIPVSQIPMTASGK
VDRRRLREGLEDLTGDYAEAASSTTQSLDGVSDWTRTESIIADVISRSTKVPRDEIRRWTPFAALGIDSVTAIEL
SRLLGSRLETWVSISLILQNPSVAQLAKSLGMREEAGVDTGTDRSDVLLANLFKEVGSALGRDPEDVEDILPCTP
LQEAMLSRGTGSYYNKILLRIRIHADDMKAYWEEMSRRHGILRTCFVTTRRADHPIAQVILRRWRVPWKTYDVQA
PSLAGVSDEHLKCLPEPLDSGLPPISCAIMRYKESTFFSLICHHAMYDGVAMDNLWREIEALANHRSLPPPVPYK
PFIKKTVDVPADTETFWLEQFHGFRPCRLFTRLAGAQANQCTHTRSFDMTLTEVQELCEGPDVAFGIVVNGRIAD
MEGLDRLVAPCFNTIAMRVDVSSASRNIDVARKLQDLNIRMIPYQFTPLRKIQKVVDCGRRALFDTLLLLQQPLK
EMDDGVWTLEEDSGNMDVPLVCEIVPCPNLNSIILNIHYDIGIVSRDVSACLADAFIYAFRHLMDVPLATPTGKS
TMPEALRSGLVDLVPRRDKPEDKSRERSGDEIWTETEKKIQAVFSQLSGVPPTKIGRDTSMFQLGLDSINAVQVA
SMLRQEGCRVSASEVMECANCASLARRLLAAPEQKLQETAQCISLDGFANDVFSQTADAMSSLGDQVKTILPATP
MQSAMLASFISSKGHNYLNRLELEMNDAINVETLQRALTVLQRRHPMLRTGFVSVRHAESSFAMIQYDGVHGGRS
VVESDNLKRSQIFDLSEWQQETRRRMLESLHLPLWKAVLVTQGDRLTLHLTMHHALYDAESLRELLQSLSRLLLD
GKEPSFSKVEPALNEVLNRGLRGQEAAQEFWTKHASNAVVNKFPCLTPLREDTVGLLTHETTSSMSCRFLFEAAK
NCGCSIQALVQAAWTRVLASYHGENSVVFGITLSGRVTDDTRAAPVPCIVTIPVVARNVESNRELIDTMMEFNAE
MHKHQFAPLSRIQKWLGHPAVPVFDTLVVYQKGDKKKTIRPPWRIVKDEAVVDYAISLEVEPDLEDDDRMCLRLT
FARNLIPEKQARLIVQQFDATLHHLASEPAGNEAGLYRKRPELFAVTPASMSDLPAPVQFLHEFVENSSKIQPEA
IALEFLDDWDIKLGPKRWSYRELDLMGNRVANQLREHVEPGDIVALHFQKCAEAYFSILGILKAGCAFVALDTQA
PKARKDFILSDSQARCLLAEDGVVMDLETPIKVLGIAEESLRKLPDQRPSWVDSSLTPGHTCYCLYTSGTTGTPK
GCEISHENAVQAMMAFQDLFKGHWDADSRWLQFAALHFDVSVLEQYWSWALGITVVSAPRDLILDDLAGAIRRLG
ITHVDLTPSLARLTSPEEMPSLRVFITGGEQLKQEILDKWGPRAVIYNAYGPTEATIGVTTYPRVPVNGRPTNIG
RQFPNVGSYVFRPLTEAPVLRGAVGELCVSGKLVGKGYLRRPDLAEERFPELAEFGERVYRTGDLVRILHDGCFD
FLGRADDQIKLRGQRLEMGEINHAIRAGAADVLDCATLLVHRESPGKDVLVSFVVGRGSGSGLQRLSLLRDEEGL
GAQARAACLGRLPAYMVPTYFLRVSLIPLSANNKVEAKELKAMFQSLSHEELMRLSAAAVALPSGVDEVVMGTVI
DIVAEFSGVAEESITPSTSLFDVGVDSISALQLTASLRRRGFQAASPTLLLRWPIIAHLVKALAEDSASDAARMG
ASAVREARQSLQACHHRHLPLVCRELDVGPGDVEYIAPCSPLQQGIIFKALAGDGSGSYFSSFEVKLSSRVSIGK
CREAWSRTVDAHAILRSVFVNTPDGHVQAAMKRAECQWQEVRFETEEELGLTLESKRRDWVARNRHHLCHPIELI
QADGPNSQRLFLHLFHALYDGSSLRLVSQYAMALYRDEQPLSSPPFIEALAHGPLSRHDDCRKFWKKHMHGWMPS
PMPTLVESSENRRGVITHREVPLDRLERLRRLQNVTMQSVVLALWASVLQRRLAGSVTVGVILSGRSIDLAGVEG
TIGPLFNTVPLFIDGRERTWSSLIREVHAFNTAVMSFQHVPLKDIQRWCSEGRPLFDNLFAFQLEQPGWCDEAAP
WELYDGVVHPDYPLALEATRTLGGNLRLCLVSQSSYADADMLEDMLNQLERSTEMAETEEAMASPCQIRTEHSQV
AAVGEPEQEDLEAEFDWTEEAVVVREEISLLARVSPEQVAPTTRLLELGLDSIDAMKLSSRLRKRGINLSTSDVL
RSQTIARLVGQLETRGGGFSSGPQSLKALEEMRPRLWIEVEKAGIEMKTVESVLPPTPLQEAMVVGMVQSGCRWY
FNHDFLEVADWVDMERLNIAWRNLVEASPCLRTGFIQVGDSDLDMSYCQVIFKSGNTDCVKTPTLSDESEMEQLT
LEATGLAVRGKGLRDLVQFVPVTVRERRLVILSMAHALYDGWSLGLLNRHLEALYWGRTTETRASADGFVERVLA
SRTDEAQAFWTGHLAGLRPTMLKGIKTTMGGEPLRREARSVYSLSRLTSFCKGQAISLQVLCVAAWAAVAAERTE
GLDVVFGLVLSGRDGEGVEDLVFPTMSTVALRCVLHGSVSSFLGYLEQTVAEVRGYQHYPLRRAQAAGAFNSLFL
FQKAAEQDEGSSRLLRSVDGRSAAEYPVCVEAEPVGQGLVWRIACHDGLFSDDDAKMLLGRLDRVLGYMMDNETT
ALLSFQDEGVSICGLPAVGIDEEGERAVDSRSEGADIEASQGEVWGDMAMTIRDVLSLVSGVAVESMTLGSSLYQ
LGLDSISAVKVSMLLRKRGIGLTPRELIKLPSLREMVGYARLLEQVAETKPPGPGFRWTPPPSVGVEKLIRESGI
SPGCVEAMFPATPMQVYMLTAWEKPGGAVFFPEFRYRVDGTDDVGRVREAWEKLSGEMAVLRTRFLSTGLDVVPW
VQVVITREASREASQPLARLRMIKAVSGRGVELRLKIHHALYDGVSLEALMARLCDLVNRDGQAEDYEDGLSRWA
LYCSALPDGRDRRREFWTEYLKGGTAVEIAVSSSVKNMAERTSYLDESAIKDITSLRTRASQHDTSLQALVLAAL
AMSLGNSSMDTNRSIIVGIYLANRAGEDWPPSTYPTLSLVPLKIRLGPGLGLVDVAQAIQADILSFGEEGRAGVG
LWEIVAWMGPSVDLEASIKGKALAVGVFGPSGRVSRSWAAELVAETAGLLKEAAKDGVEMGE*
Coding >Ophun1|6954
ATGCCGGCATCGGACAGCATCTTCCGTATCAAGCAGCTCATCGTGTCCATGGCAGCATCAGTCGGTCATGCCTCG
CATGGTCAGTGCGACTGGACGGCGGATCCATTCATGGTTCATGGCGTCATGTTGCTTCTGTTGGCGACGCTGTCG
TTGCTCGCGTCGCCGCTTCACCTGGATCGGAACGGAAATGGCTCCTTCACGTATCGAGAATTTCATGAGGCTGCG
GCGGCAATTGCCAGCCTCCTTACTGATGCAATTCGGTCTCCTGAGCGGAGTCGTTCTTCATTCATCGTCCCCGTC
CTCGTCCCTCAGTCGTCCTTACTCTGCATCTCTTTGCTCGCTGTTCTGAAGGCTGGCGGTGCTTTTTGCCCTCTC
AATTTTGATAGCCCTCGTGAGAGAATCAGATTCATCGTCAAAGACGTCTCCGCTACCGTTGTTCTCGTCACACGC
GCCCTGGCGCATTTGGTGCCCGTCGAAGATGTTGAGAAAGTCATCGTGGTTGATGACTTCGAACTTGGAGACCCC
AGCTTGCCGACCATCGACTACCTGGAATCTGCTCCTGAAGATCTGGCCTATGTCATGTATACATCTGGATCGACG
GGGACGCCCAAAGGTGTCTGCATCTCGCATGATGCTGTAACGCAAGCCCTCCTTGCACACGATCGTCACATCCCG
GCCTTTTCAAGGTTTCTGCAGTTTGCTGCACCCACATTTGACGTCTCAGTCTTCGAGATCTTCTTCCCCCTTTTC
CGCGGCAGCACTCTGGTTACAGCAAGCCGCGATGAGCTGCTGGATGATCTGCCCGCAGTTCTACGGAGGACGAAG
GTCGACGCCTGCGAGTTGACACCCACGGTCGCTGCGAGCCTGCTCCGAAGACGCCAAAATGCCCCTGCCCTGAAG
CTTCTTCTGACCATTGGCGAGATGCTGACCCTTCCCGTCGTCGAGGAGTTTGGCGGGTCGGAAACCAGACCTAGC
ATGCTATGGGCCATGTATGGACCGACAGAGGCCACCATTCATTGCACGCTGCAGGCCGCCTTGCCGTCCAACTCA
CCAGTAAGAAACATTGGAATTCCTCTTGATACAGTATCCTGCTTCGTCGTGGATGCTCGTGTCTCTGCTCAAGGA
GGAAGCGACGTCAGGGTTCTCCCACGAGGCCAAATCGGAGAACTGGCTGTCGGCGGTTACCAGTTGGCCAGCGGT
TATCTCAATCGTCCGGAGCAAACTGCATCTGCCTTCATAACCACACCGTACGGCCGACTTTACCTGACAGGAGAC
CGAGCTCGGATGACGCCTGATGGAATGCTCGAGTGTCTTGGTCGCTTGACGGGTGGACAATTGAAGCTGCGTGGC
CAGCGCATCGAGACTGGCGAGGTCGAGCAGTCGGCTCTCAGAGCTTCTGGCTGCCACGGCGCCGTAGCAGCTGTC
ATTGACGCCAATCTGGTTCTGTTCTGCGCCGTTGATCCCGGCACGTCCGAGGATGACATTGCCACCTGCTGCAAG
AGCTGGTTGCCTCGCTTCATGGTGCCCGGGGAGATTGTCTTAATGGCCGAGTTCCCTTGCTTGCCAAGTGGCAAG
GTTGACAAGCCGAAGCTGAAGTCATTACATCAAGAGCAGAAGTCGACCGAACCGTCTGAATACGATGAGAACTTA
CTGGCTGAGGAGCACGAGGTTGTTCGTGTCATTTCGTCAGTCCTGGGTCGACGAGTAAACAGGCAGATGCCTCTG
CCCTTAGCCGGCGTAGATTCGCTTTCAGCAATCAAGCTGGCATCTGCGCTGCGAGTCTCGGGCTTCAGGATGGAA
GTTTCGGATCTGCTGAGCCTGAAAACAGTAGCAGACCTTTGCTGCCAGATCCGCAAATCGCCCATGGTGAAGCCA
TCAAATCAACAACCTTGTGTGAGCATCCTTGCGGACTTGGACACCATTCTGGCTCAGCATCCCGGACTGAACCTG
AAGAAAGAGAACATCAATGATGTTATCTCATGCACTCCACTTCAAACGGCCTTGCTAGCCGAGACAGCGAGGGAC
CCCCTTCTCTATTGCAACCAAGTCGAGTTTGAAGTGGCTCCGGGGTTTACAATTCAAGAAGTCTCGGCTGCAATC
TGCCGAGTTGCAGCGGATAACGAAGCCCTCCGCTCAGGCTTTGTCGAGGCTCGTGGCGGGTATGCTGCCATCGTG
TTCAGGACGTTTGGGACCGACGACAACCTCCGCGTCGTGTCTCACTTCGACGAGAGCTTCTCTTTCAAGGAACCA
GGCGACTTTCTCAGACCATTTCGCGTCCAGATCCGGGGCCTTGATGTCCGACTGAGAGTTCTTTTTCAGGTTCAC
CACGCAGTTTACGATGGGTGGTCCATGGATCTGATCTTGTCTGACCTGTCTGCGCTGCTCAGGCGTCAGCCACTT
TCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGTCATCACCTGAGAGACTCCAAGGATGCCGATGAAGAATTGGCC
ATGAAATTTTGGGGCGAGTATTTGGCGGGTTGGAACAAGTCTTCTTTTCCGAAGCTGGCTGCACGACTTCAAATG
TCGAATGTGATCAAGAAAACGAGCTGTACGTTTCAGATACTGCCCGATTCCGTTAGAAAACTGGCAGGAGAGCGG
GCGATAGGCGCCCAAGTACTCTTCCAAGCTTCTCTGGCTTTGCTCTGGAGCGGCATTGCGGGAGATCAGGACCTG
GTGCTTGGATCGGTGACGTCCGGACGGACGATACCCGTGGACCAGATTGAGGAAATTCTTGGCCCTTGCTTTGCG
TCTCTGCCTGTCCGAATCGATCTGAGCGACATGGTATCCGGCAAGGACTTGCTGACGAGCATCCAAGCAAGCAAT
CGGGCGATGATGCAGCACTGCACATTGCCCCTTTCAGGAATTCGGACTTTGGCAGGGCTTCAGCCAGCCGAGAGC
CTGTACGATGTTTTGCTTGTCTACCAAGAGTCTCTAGAGAGTCTGAACAGAAAAGACTGGCTCTTTGCAGAAGTA
AACCACCTGGATCGGCTCGAGACGAAGCTGTTGCTCGAGATACAGCCTCACGAGACATTCTACTCGATACATGCT
ACTTACCATTCGTCTTTCTTTGCTCCAGGATTGGTTGACTGTCTCCTTCAGCAGCTCGAGGACGTGACACGGATG
CTGCTGGAAAGTCCAGATGCGGGCTTGCAATCCATACGGTCCGCCGCTCCTGGGAACTCGGTTCACAATATAGCC
GTGCAGCCGTTCCACGGAGTGCCTGACCTGGCTGCTCAATTCGAGGCCACGGCGGCTGCTATACCTACAGCGACC
GCGCTGTGCTTTTGCGAATCTCTGGCTTCTTCCGGTCCCCGAACCATCTGCATGTCCTATGAAGAGCTGAACAGA
GCTGCTAACCGAGTAGCCCGGTATCTGAGAAGCCAGGCAATCACCGTCGGTGAGGTCTTGGCTGTGCTCATGCAG
AAGTCACCCGCGTTTTATACTGTTGTTCTCGGGATTCAAAAGGCGGGATGTGCGTATCTGCCCATTCTTCCGCAG
ACCCCTGAGGCGCGGATACGCACGATCCTTGAGCAGGCTAGAGTCGAGCACTGTCTCGTGGACAATAGCTCAATT
TCGTCGTCTCTGCTGAAGGGCGTTCAGATCCATGACATGGAGCGCATTGAGTTGCAGCAATACTCATCGAAGAAT
CAAGATATCCCCTACAACGCTTCTCGACTGGCCTATGTCGTCTACACCTCGGGAACAACGGGGGTACCAAAGGGC
GTTGCTGTCACGCAGGAGAACATCGTGAGTAACATCACGGTCTTGCAATCGACATATCCCACGCCCAAGACGTCC
GAGCCGCGACTGCTTCAAGCCTGTTCTCAAGCCTTCGACGTGTCTGTCTTCGAAATCTTCTTCGCCTGGCACGCG
GGCATGTGTCTGTGTGCAGCTCCCAATGACGTCTTGTTCCAAGACCTAGAGCGTTTCATGCGACTTCTGAAGATT
AGCCACCTGAGCTTGACGCCGACGTTGGCGTCTCTTATAGAGCCCGCCAACGTACCCGAGGTCGAGTTTCTCGTC
ACGGCAGGCGAACCGATGACGATGGCCGTCTTGGACCGATGGCACGACCGGCTTTGGCAAGGTTACGGGCCATCC
GAGACGACCAACATATGCAGCGTGAAGCACATGGCGCGCGGAGACAACATTGAGCATCTCGGCTGGGCGCTTCCC
AACACTTCCTCGATCGTTATGCGGCCAGGTGCGGCCAATACTGTTCCTGTCGGATGGGTGGGCGAGCTCTGCTTC
GGCGGCCATCAGGTAGCGAGGGGATACTTGAACGATCACCGTCTGACGAGAGAAAAGTTTCTGTATGACCCGACA
TATGGGAGGATATATCGTTCCGGAGATTTGGGTCGGATGCTTCCGGACGGCTCGCTGGTGATCCTCGGACGGCTC
GATGATCAGATCAAGCTTCGAGGCCAGCGAATTGCGGCTGGTGAGATTAACAGCATAATTACCTCGACGGGTCTG
GCAACCACCGCGGTGACAATCTCGGCTCGTCGACGAACAGATGCCCCGGAACAGCTCGTGTCGTTCTTTGTGACT
TACGGGACTGGATCTGAGTACAGCACGCTGGACGTTTCTCCGGAAGTCAACCGCCATCTCTTTGCCTACTTACAG
TCTCGACTGCCACCGTATATGGTGCCGTCGTACTTGATTCCCGTATCTCAGATACCCATGACGGCAAGCGGAAAG
GTGGACCGGCGACGTCTTCGCGAGGGTTTGGAGGACTTGACCGGGGATTACGCAGAGGCCGCTTCTTCTACCACG
CAAAGTCTCGATGGCGTGAGCGACTGGACTCGTACGGAGTCAATCATCGCCGACGTCATCTCGCGATCAACAAAG
GTTCCGAGGGACGAAATCAGGCGGTGGACGCCGTTTGCGGCTCTGGGCATCGATTCAGTCACGGCCATAGAACTG
TCTCGGCTGCTGGGCTCTCGCTTGGAAACCTGGGTGTCGATATCCTTGATTCTCCAAAACCCATCCGTTGCGCAA
CTGGCCAAGTCTTTAGGGATGAGGGAAGAAGCAGGCGTCGACACTGGTACTGACAGGTCAGACGTGCTGTTGGCG
AATTTGTTTAAAGAGGTCGGCTCCGCCTTGGGCCGCGATCCGGAAGACGTCGAAGATATCCTTCCGTGTACACCC
TTGCAGGAAGCCATGCTTTCACGGGGAACGGGAAGCTATTACAACAAGATCTTGCTACGGATCCGCATTCACGCC
GATGATATGAAGGCGTACTGGGAGGAAATGTCGAGAAGACACGGGATACTCAGAACATGCTTCGTCACAACGCGC
CGCGCCGACCATCCGATTGCCCAGGTGATTCTAAGACGATGGAGGGTTCCGTGGAAGACGTACGACGTTCAGGCT
CCCTCTCTCGCTGGCGTATCCGATGAGCATCTCAAGTGTCTACCGGAGCCCCTGGACTCAGGATTGCCCCCTATT
TCCTGCGCCATCATGCGATACAAAGAGTCGACGTTCTTCTCGCTTATTTGCCACCATGCCATGTACGACGGCGTC
GCTATGGATAATCTTTGGCGAGAAATCGAGGCCCTGGCCAACCATCGCAGTCTCCCTCCCCCCGTGCCCTACAAG
CCGTTCATCAAGAAGACCGTCGACGTTCCCGCGGACACTGAGACCTTCTGGCTAGAGCAGTTTCACGGCTTCCGG
CCTTGCAGACTCTTCACGCGCTTAGCTGGTGCTCAGGCAAACCAGTGTACTCATACCAGGTCTTTTGACATGACG
TTGACTGAGGTTCAGGAGCTATGTGAAGGCCCAGATGTCGCCTTTGGTATTGTCGTGAACGGTCGCATCGCCGAC
ATGGAAGGTCTGGACCGGTTGGTCGCTCCCTGCTTCAACACAATTGCGATGCGTGTCGATGTTTCAAGCGCTTCC
CGGAACATCGACGTGGCTAGAAAGCTGCAGGATCTCAACATACGGATGATTCCGTATCAGTTCACTCCACTGCGA
AAGATCCAGAAGGTCGTTGACTGCGGACGTCGAGCGCTGTTTGACACCCTGCTTCTCCTTCAACAGCCTCTCAAA
GAGATGGACGATGGTGTCTGGACGCTGGAAGAAGATTCGGGTAATATGGATGTCCCGCTGGTGTGCGAGATTGTT
CCCTGCCCAAACCTCAACTCGATCATTCTCAACATTCACTACGATATCGGCATCGTCTCTAGGGACGTGAGTGCG
TGTCTAGCTGATGCTTTCATATACGCTTTCCGACACCTGATGGACGTGCCCTTGGCGACACCAACCGGCAAGAGT
ACTATGCCAGAGGCTCTCAGATCGGGCCTCGTGGATCTCGTCCCAAGGCGTGACAAGCCGGAAGACAAGAGCCGC
GAGCGTTCTGGAGATGAGATCTGGACTGAAACTGAGAAGAAGATACAGGCAGTCTTCTCGCAGCTTTCGGGTGTG
CCGCCGACGAAGATTGGTCGCGATACTAGCATGTTCCAGCTTGGATTGGATAGCATCAATGCTGTCCAGGTCGCT
TCGATGCTTAGACAGGAGGGATGCCGGGTTTCTGCATCTGAAGTCATGGAGTGCGCCAACTGTGCAAGTCTGGCC
CGTCGGCTTCTTGCTGCCCCAGAACAGAAGCTGCAGGAGACTGCTCAGTGTATCAGCCTGGACGGATTTGCCAAC
GACGTCTTCTCACAGACAGCCGACGCCATGTCGTCTCTTGGAGACCAGGTTAAGACAATTCTTCCGGCTACTCCG
ATGCAGTCAGCCATGCTGGCATCATTCATCTCATCAAAGGGTCACAACTATCTCAACAGGCTCGAGTTGGAGATG
AACGACGCTATCAACGTGGAGACCCTGCAGCGGGCTTTGACGGTGCTTCAGCGACGGCATCCGATGCTCCGCACC
GGCTTCGTTTCGGTGAGACACGCGGAAAGCTCGTTTGCGATGATACAATATGACGGAGTGCATGGCGGCCGGAGT
GTTGTCGAGAGCGACAATCTCAAGCGGTCACAGATTTTCGACTTGAGCGAATGGCAACAAGAAACTCGAAGAAGA
ATGCTCGAATCGCTTCATTTGCCACTCTGGAAAGCAGTTCTGGTTACGCAGGGGGATCGACTGACACTTCATCTC
ACCATGCATCACGCCCTTTACGACGCTGAATCCCTGAGGGAGCTCTTGCAAAGCCTCTCACGCCTTTTGCTAGAC
GGCAAAGAGCCCAGCTTTTCCAAAGTCGAGCCGGCTTTGAACGAGGTCCTGAACCGGGGACTTCGAGGGCAGGAG
GCTGCACAGGAGTTCTGGACCAAGCATGCGAGCAACGCCGTGGTGAACAAATTCCCATGCTTGACGCCTCTGAGA
GAAGACACGGTTGGGCTGTTGACACACGAAACAACTTCGTCCATGTCTTGCCGCTTTCTCTTCGAGGCCGCAAAG
AACTGCGGCTGCTCGATTCAGGCCTTGGTGCAAGCCGCGTGGACGCGCGTGTTGGCGTCGTATCATGGCGAGAAC
TCGGTGGTCTTTGGCATCACATTGTCTGGGCGTGTTACTGATGACACTCGGGCTGCTCCGGTTCCCTGCATCGTT
ACGATTCCGGTTGTGGCACGCAACGTGGAGTCCAACAGAGAGCTGATCGATACCATGATGGAGTTCAATGCTGAG
ATGCACAAGCATCAATTCGCTCCCCTGAGTCGCATCCAGAAGTGGCTGGGCCATCCCGCTGTACCAGTCTTCGAT
ACTCTCGTTGTGTACCAGAAAGGAGACAAGAAGAAGACGATTCGTCCACCTTGGAGGATAGTCAAGGACGAGGCG
GTTGTTGACTATGCTATCTCTCTCGAAGTCGAGCCAGATCTTGAGGATGATGATCGGATGTGCCTTCGACTCACC
TTTGCCAGAAACCTCATACCGGAGAAACAGGCTCGTCTCATTGTCCAACAGTTTGACGCCACGCTGCATCATCTG
GCTAGCGAGCCAGCCGGAAACGAAGCTGGACTCTATAGAAAGCGGCCCGAGCTCTTTGCTGTCACTCCGGCTTCG
ATGTCCGACTTGCCCGCTCCGGTGCAGTTTCTTCACGAGTTTGTGGAGAACAGCAGCAAGATCCAGCCAGAGGCG
ATAGCCCTCGAGTTCCTGGACGACTGGGATATTAAGTTGGGCCCAAAGAGATGGAGCTATAGGGAACTCGACCTC
ATGGGAAATCGAGTCGCCAACCAGCTACGGGAGCATGTCGAGCCTGGAGATATCGTGGCACTTCACTTTCAAAAA
TGTGCTGAGGCGTATTTTTCGATACTGGGCATTCTCAAAGCCGGCTGTGCGTTTGTGGCTCTGGACACCCAAGCC
CCAAAGGCGAGAAAGGACTTTATTTTGAGCGATTCTCAGGCGAGGTGTCTCTTGGCGGAAGATGGAGTTGTGATG
GATCTTGAAACTCCAATCAAGGTTCTAGGAATCGCTGAAGAATCGCTTCGAAAGCTGCCTGATCAGCGTCCGTCT
TGGGTCGACAGCAGCCTGACGCCTGGTCATACCTGCTACTGTCTCTACACGTCCGGCACGACGGGAACGCCAAAG
GGATGCGAGATCAGCCACGAGAATGCGGTTCAGGCCATGATGGCGTTTCAAGACCTGTTCAAAGGGCACTGGGAC
GCCGACTCTCGCTGGCTTCAGTTCGCGGCGCTTCATTTTGATGTCTCGGTGCTGGAGCAGTACTGGAGTTGGGCC
TTGGGCATCACAGTCGTGTCTGCGCCCCGAGACCTGATACTGGACGATCTCGCAGGGGCTATTAGAAGACTCGGT
ATCACGCACGTCGACCTTACTCCCAGCCTTGCCCGGCTGACGAGTCCGGAGGAGATGCCCAGCCTACGTGTCTTC
ATCACTGGAGGAGAGCAGCTGAAGCAGGAGATACTCGACAAATGGGGCCCGAGGGCCGTCATATATAACGCCTAC
GGTCCTACGGAGGCGACTATCGGGGTTACCACGTATCCGCGTGTGCCCGTCAACGGGAGGCCGACCAACATTGGC
AGACAGTTTCCCAATGTCGGCTCTTACGTCTTTCGACCCCTGACGGAAGCCCCCGTGCTGCGAGGCGCCGTCGGA
GAGCTGTGCGTGTCGGGAAAGCTGGTGGGCAAGGGTTATCTTCGGCGTCCGGACCTTGCTGAGGAGCGGTTCCCG
GAACTGGCAGAGTTCGGGGAGAGGGTGTACCGGACGGGCGACCTGGTTCGGATCCTCCACGATGGATGCTTCGAC
TTTCTCGGCCGGGCAGACGATCAGATCAAGCTGCGTGGACAACGGCTGGAGATGGGTGAGATTAACCATGCTATC
CGTGCAGGGGCAGCTGATGTGCTCGACTGCGCAACGCTGTTGGTGCACCGAGAGTCTCCAGGCAAGGACGTTTTG
GTGTCCTTTGTTGTCGGACGGGGATCCGGAAGCGGGCTTCAACGACTCTCTCTGCTGCGAGACGAAGAGGGACTC
GGTGCTCAGGCGAGAGCGGCGTGTCTGGGGAGGCTGCCGGCTTACATGGTGCCGACCTACTTTCTTCGGGTGTCG
TTGATACCGCTCTCGGCGAACAACAAGGTCGAAGCTAAGGAGCTCAAGGCAATGTTTCAGTCGCTTTCGCACGAG
GAGCTGATGAGGCTGTCGGCTGCGGCTGTGGCTCTTCCGAGTGGCGTCGATGAGGTTGTCATGGGCACCGTCATC
GACATCGTGGCCGAGTTCAGTGGCGTGGCAGAAGAGAGCATCACACCGTCGACCAGCTTATTCGACGTCGGCGTG
GATTCCATCAGCGCTCTACAGCTGACCGCCAGCCTTCGTCGACGAGGTTTTCAAGCTGCCTCTCCTACTCTGTTG
CTGAGGTGGCCCATCATCGCGCATCTCGTCAAAGCCCTGGCCGAAGACTCGGCGTCAGATGCGGCAAGGATGGGA
GCCAGTGCTGTGAGAGAGGCTAGACAATCTCTACAAGCCTGTCATCACAGACATCTTCCGCTCGTGTGCCGAGAG
CTCGACGTCGGGCCGGGAGACGTGGAGTACATTGCGCCATGCTCGCCGTTGCAGCAGGGCATCATCTTTAAAGCT
CTTGCCGGTGATGGTTCTGGCTCTTACTTTTCTTCTTTCGAGGTTAAGCTGAGCAGTAGAGTCTCGATTGGAAAG
TGTCGAGAAGCCTGGAGTCGGACTGTCGATGCTCACGCCATACTGAGATCCGTCTTTGTCAATACCCCTGACGGC
CATGTTCAAGCGGCGATGAAGCGAGCAGAGTGCCAATGGCAAGAGGTGAGATTCGAAACTGAAGAGGAGCTCGGT
CTCACCCTGGAATCGAAACGACGAGACTGGGTCGCGAGAAACAGGCATCACTTGTGCCACCCCATCGAGCTCATC
CAAGCAGATGGGCCAAACTCACAGAGATTGTTTCTGCATCTGTTTCACGCGCTATACGATGGCAGCAGCTTGCGA
CTCGTCAGTCAGTACGCCATGGCCCTTTACCGAGACGAGCAGCCGCTGTCTAGCCCTCCTTTCATCGAGGCGTTG
GCCCACGGACCTCTCTCGAGGCATGACGACTGCCGAAAGTTTTGGAAGAAGCACATGCACGGCTGGATGCCGTCA
CCGATGCCGACGCTCGTAGAATCATCAGAGAATCGCCGAGGCGTCATCACTCATCGCGAGGTTCCGCTTGATCGA
TTAGAGCGACTTCGTCGGCTGCAGAACGTGACGATGCAGTCTGTCGTGCTGGCGCTGTGGGCTTCAGTCCTTCAG
AGACGTTTGGCCGGTAGCGTCACAGTCGGCGTCATCCTTTCGGGCCGGTCTATCGACCTTGCTGGAGTTGAGGGC
ACCATCGGTCCTCTATTCAACACGGTGCCTCTTTTCATCGATGGACGAGAGAGGACATGGTCATCGCTGATCCGC
GAGGTCCATGCTTTCAACACTGCGGTCATGTCTTTTCAGCATGTGCCCCTGAAGGACATTCAGCGATGGTGTTCT
GAAGGTCGTCCGCTCTTCGACAATCTCTTTGCCTTTCAGCTCGAGCAACCCGGATGGTGCGACGAAGCTGCGCCG
TGGGAGCTCTACGACGGAGTGGTCCATCCCGACTATCCCCTGGCGCTGGAGGCGACGCGGACCTTGGGGGGGAAC
CTGCGGCTTTGCCTCGTCTCGCAGAGCAGCTACGCCGATGCTGATATGCTTGAGGATATGCTGAATCAGTTGGAG
AGATCCACGGAGATGGCGGAAACGGAGGAGGCCATGGCGAGTCCCTGTCAAATCCGTACCGAACACTCGCAGGTG
GCCGCAGTCGGAGAACCGGAGCAAGAAGACTTGGAGGCCGAGTTCGACTGGACGGAGGAAGCTGTCGTGGTAAGA
GAGGAGATTTCGCTGCTCGCTCGCGTGTCTCCTGAGCAAGTCGCTCCAACGACCAGGCTGCTGGAACTGGGCCTT
GACAGCATTGATGCCATGAAGCTCTCGTCGAGGCTGAGGAAGCGCGGAATCAACCTTTCTACCTCGGACGTTCTG
CGGAGCCAGACGATAGCCCGTCTTGTTGGCCAGTTGGAAACGAGAGGCGGCGGATTTTCCTCTGGACCTCAGTCT
CTGAAGGCTTTGGAAGAGATGAGGCCTAGGCTCTGGATCGAGGTGGAGAAGGCTGGGATAGAGATGAAGACTGTG
GAATCGGTTCTGCCCCCGACTCCCCTTCAAGAAGCCATGGTTGTGGGAATGGTTCAGTCAGGCTGTCGGTGGTAC
TTTAACCATGATTTCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTTAACATTGCGTGGAGAAATCTGGTT
GAGGCATCGCCATGCCTGAGGACCGGCTTCATCCAAGTCGGCGACTCGGATCTGGACATGTCGTACTGCCAGGTC
ATCTTCAAGAGCGGCAACACGGATTGCGTCAAGACGCCGACGCTGTCGGACGAGTCTGAGATGGAACAGCTGACG
CTGGAGGCGACGGGTCTCGCAGTCAGAGGCAAGGGGCTACGAGACTTGGTGCAGTTTGTGCCGGTGACGGTGAGA
GAGAGGCGTCTCGTGATCTTGTCCATGGCTCATGCTCTCTACGATGGCTGGTCACTGGGGCTCCTGAATCGCCAT
CTTGAAGCGCTTTACTGGGGTCGGACGACGGAGACGAGGGCGTCGGCCGACGGCTTTGTCGAGCGGGTGCTTGCG
TCGAGGACGGATGAGGCGCAAGCGTTCTGGACTGGTCATCTCGCGGGTCTTCGTCCGACTATGCTCAAGGGTATA
AAGACGACGATGGGAGGAGAGCCGTTGCGCAGAGAAGCCCGATCCGTCTACAGCCTCTCTCGGCTGACGAGCTTC
TGCAAGGGTCAGGCCATCAGTCTGCAGGTTCTCTGCGTCGCCGCTTGGGCTGCCGTTGCAGCAGAGCGAACCGAG
GGTCTCGACGTCGTCTTCGGGCTCGTGCTATCGGGGCGAGATGGCGAGGGGGTGGAGGATCTGGTGTTTCCAACG
ATGAGCACCGTGGCCTTGCGCTGTGTTCTTCACGGGTCTGTCTCGAGCTTCCTCGGCTATCTGGAGCAGACGGTT
GCGGAGGTCAGGGGCTATCAGCACTATCCCCTGCGAAGGGCACAGGCTGCCGGTGCCTTCAACTCGCTGTTTCTC
TTCCAGAAGGCAGCCGAGCAGGACGAGGGGTCGAGCCGGTTATTGAGGTCCGTCGACGGGCGGTCTGCTGCCGAG
TATCCGGTCTGTGTCGAGGCCGAGCCCGTCGGTCAGGGGCTCGTCTGGCGGATTGCATGCCATGATGGGCTCTTC
TCCGATGACGACGCGAAGATGCTACTTGGAAGGCTGGACCGAGTGCTGGGTTACATGATGGATAACGAGACGACC
GCTCTTCTCTCGTTTCAAGATGAGGGTGTCTCGATTTGCGGCTTACCGGCTGTGGGCATCGACGAGGAGGGGGAG
CGAGCCGTCGACTCAAGGTCTGAAGGAGCTGACATCGAGGCCAGCCAAGGGGAAGTATGGGGAGACATGGCCATG
ACGATTCGTGACGTCTTGAGCCTGGTTTCGGGCGTGGCAGTCGAGTCGATGACGCTCGGAAGCAGTCTATACCAA
CTCGGGCTCGACTCTATCAGTGCTGTCAAGGTATCGATGCTTCTGCGCAAGAGGGGCATCGGTCTGACGCCGAGG
GAGCTCATCAAGCTGCCGTCGTTGCGGGAAATGGTAGGCTACGCGAGGCTCCTAGAACAAGTTGCGGAGACGAAG
CCCCCCGGTCCGGGCTTCAGATGGACGCCTCCTCCGTCCGTGGGCGTTGAGAAGTTGATACGAGAGAGTGGCATA
TCGCCAGGTTGTGTTGAGGCCATGTTTCCGGCGACGCCGATGCAGGTCTACATGCTCACGGCGTGGGAGAAGCCT
GGAGGCGCCGTCTTCTTCCCCGAGTTTCGCTACCGGGTTGACGGCACGGACGATGTGGGCAGAGTGCGAGAGGCG
TGGGAGAAGCTCAGTGGCGAGATGGCTGTGTTGCGGACACGCTTCCTGTCTACAGGCTTGGACGTGGTGCCGTGG
GTGCAGGTTGTCATAACCAGGGAGGCCAGTCGGGAGGCGTCACAGCCCCTGGCCCGTCTGAGGATGATCAAGGCC
GTCTCGGGCCGTGGCGTTGAGTTGCGGCTCAAGATACACCACGCGCTGTACGACGGGGTCAGTCTCGAGGCGTTG
ATGGCGAGGCTGTGCGATCTCGTGAACAGGGACGGTCAAGCCGAAGACTACGAGGACGGCTTATCGCGATGGGCG
CTCTACTGCAGTGCTCTGCCAGACGGTCGAGACAGACGGCGAGAGTTCTGGACCGAGTATCTGAAGGGAGGCACA
GCCGTGGAGATTGCAGTCTCGTCGTCGGTGAAGAACATGGCCGAGAGGACGTCGTATCTTGACGAGTCGGCCATC
AAAGACATCACGTCTCTACGAACAAGGGCGTCACAGCACGACACAAGCCTCCAGGCCCTCGTCCTCGCAGCGCTG
GCCATGAGTCTCGGCAACAGCAGCATGGACACAAACCGAAGCATCATCGTGGGCATCTACCTCGCCAACCGCGCA
GGGGAAGACTGGCCTCCATCGACGTATCCGACGCTCAGCCTGGTTCCGCTGAAGATTCGGCTGGGGCCGGGGCTG
GGACTCGTCGACGTCGCTCAGGCGATTCAGGCTGACATCTTGAGCTTTGGAGAAGAGGGACGGGCGGGCGTGGGC
CTTTGGGAGATTGTGGCCTGGATGGGGCCTTCGGTCGACCTGGAGGCCTCGATCAAGGGCAAGGCGCTGGCGGTC
GGCGTCTTTGGCCCCAGCGGACGGGTATCGAGGAGTTGGGCTGCTGAGCTGGTGGCTGAGACAGCTGGGTTGCTG
AAGGAGGCTGCGAAGGATGGGGTGGAAATGGGTGAGTGA
Transcript >Ophun1|6954
ATGCCGGCATCGGACAGCATCTTCCGTATCAAGCAGCTCATCGTGTCCATGGCAGCATCAGTCGGTCATGCCTCG
CATGGTCAGTGCGACTGGACGGCGGATCCATTCATGGTTCATGGCGTCATGTTGCTTCTGTTGGCGACGCTGTCG
TTGCTCGCGTCGCCGCTTCACCTGGATCGGAACGGAAATGGCTCCTTCACGTATCGAGAATTTCATGAGGCTGCG
GCGGCAATTGCCAGCCTCCTTACTGATGCAATTCGGTCTCCTGAGCGGAGTCGTTCTTCATTCATCGTCCCCGTC
CTCGTCCCTCAGTCGTCCTTACTCTGCATCTCTTTGCTCGCTGTTCTGAAGGCTGGCGGTGCTTTTTGCCCTCTC
AATTTTGATAGCCCTCGTGAGAGAATCAGATTCATCGTCAAAGACGTCTCCGCTACCGTTGTTCTCGTCACACGC
GCCCTGGCGCATTTGGTGCCCGTCGAAGATGTTGAGAAAGTCATCGTGGTTGATGACTTCGAACTTGGAGACCCC
AGCTTGCCGACCATCGACTACCTGGAATCTGCTCCTGAAGATCTGGCCTATGTCATGTATACATCTGGATCGACG
GGGACGCCCAAAGGTGTCTGCATCTCGCATGATGCTGTAACGCAAGCCCTCCTTGCACACGATCGTCACATCCCG
GCCTTTTCAAGGTTTCTGCAGTTTGCTGCACCCACATTTGACGTCTCAGTCTTCGAGATCTTCTTCCCCCTTTTC
CGCGGCAGCACTCTGGTTACAGCAAGCCGCGATGAGCTGCTGGATGATCTGCCCGCAGTTCTACGGAGGACGAAG
GTCGACGCCTGCGAGTTGACACCCACGGTCGCTGCGAGCCTGCTCCGAAGACGCCAAAATGCCCCTGCCCTGAAG
CTTCTTCTGACCATTGGCGAGATGCTGACCCTTCCCGTCGTCGAGGAGTTTGGCGGGTCGGAAACCAGACCTAGC
ATGCTATGGGCCATGTATGGACCGACAGAGGCCACCATTCATTGCACGCTGCAGGCCGCCTTGCCGTCCAACTCA
CCAGTAAGAAACATTGGAATTCCTCTTGATACAGTATCCTGCTTCGTCGTGGATGCTCGTGTCTCTGCTCAAGGA
GGAAGCGACGTCAGGGTTCTCCCACGAGGCCAAATCGGAGAACTGGCTGTCGGCGGTTACCAGTTGGCCAGCGGT
TATCTCAATCGTCCGGAGCAAACTGCATCTGCCTTCATAACCACACCGTACGGCCGACTTTACCTGACAGGAGAC
CGAGCTCGGATGACGCCTGATGGAATGCTCGAGTGTCTTGGTCGCTTGACGGGTGGACAATTGAAGCTGCGTGGC
CAGCGCATCGAGACTGGCGAGGTCGAGCAGTCGGCTCTCAGAGCTTCTGGCTGCCACGGCGCCGTAGCAGCTGTC
ATTGACGCCAATCTGGTTCTGTTCTGCGCCGTTGATCCCGGCACGTCCGAGGATGACATTGCCACCTGCTGCAAG
AGCTGGTTGCCTCGCTTCATGGTGCCCGGGGAGATTGTCTTAATGGCCGAGTTCCCTTGCTTGCCAAGTGGCAAG
GTTGACAAGCCGAAGCTGAAGTCATTACATCAAGAGCAGAAGTCGACCGAACCGTCTGAATACGATGAGAACTTA
CTGGCTGAGGAGCACGAGGTTGTTCGTGTCATTTCGTCAGTCCTGGGTCGACGAGTAAACAGGCAGATGCCTCTG
CCCTTAGCCGGCGTAGATTCGCTTTCAGCAATCAAGCTGGCATCTGCGCTGCGAGTCTCGGGCTTCAGGATGGAA
GTTTCGGATCTGCTGAGCCTGAAAACAGTAGCAGACCTTTGCTGCCAGATCCGCAAATCGCCCATGGTGAAGCCA
TCAAATCAACAACCTTGTGTGAGCATCCTTGCGGACTTGGACACCATTCTGGCTCAGCATCCCGGACTGAACCTG
AAGAAAGAGAACATCAATGATGTTATCTCATGCACTCCACTTCAAACGGCCTTGCTAGCCGAGACAGCGAGGGAC
CCCCTTCTCTATTGCAACCAAGTCGAGTTTGAAGTGGCTCCGGGGTTTACAATTCAAGAAGTCTCGGCTGCAATC
TGCCGAGTTGCAGCGGATAACGAAGCCCTCCGCTCAGGCTTTGTCGAGGCTCGTGGCGGGTATGCTGCCATCGTG
TTCAGGACGTTTGGGACCGACGACAACCTCCGCGTCGTGTCTCACTTCGACGAGAGCTTCTCTTTCAAGGAACCA
GGCGACTTTCTCAGACCATTTCGCGTCCAGATCCGGGGCCTTGATGTCCGACTGAGAGTTCTTTTTCAGGTTCAC
CACGCAGTTTACGATGGGTGGTCCATGGATCTGATCTTGTCTGACCTGTCTGCGCTGCTCAGGCGTCAGCCACTT
TCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGTCATCACCTGAGAGACTCCAAGGATGCCGATGAAGAATTGGCC
ATGAAATTTTGGGGCGAGTATTTGGCGGGTTGGAACAAGTCTTCTTTTCCGAAGCTGGCTGCACGACTTCAAATG
TCGAATGTGATCAAGAAAACGAGCTGTACGTTTCAGATACTGCCCGATTCCGTTAGAAAACTGGCAGGAGAGCGG
GCGATAGGCGCCCAAGTACTCTTCCAAGCTTCTCTGGCTTTGCTCTGGAGCGGCATTGCGGGAGATCAGGACCTG
GTGCTTGGATCGGTGACGTCCGGACGGACGATACCCGTGGACCAGATTGAGGAAATTCTTGGCCCTTGCTTTGCG
TCTCTGCCTGTCCGAATCGATCTGAGCGACATGGTATCCGGCAAGGACTTGCTGACGAGCATCCAAGCAAGCAAT
CGGGCGATGATGCAGCACTGCACATTGCCCCTTTCAGGAATTCGGACTTTGGCAGGGCTTCAGCCAGCCGAGAGC
CTGTACGATGTTTTGCTTGTCTACCAAGAGTCTCTAGAGAGTCTGAACAGAAAAGACTGGCTCTTTGCAGAAGTA
AACCACCTGGATCGGCTCGAGACGAAGCTGTTGCTCGAGATACAGCCTCACGAGACATTCTACTCGATACATGCT
ACTTACCATTCGTCTTTCTTTGCTCCAGGATTGGTTGACTGTCTCCTTCAGCAGCTCGAGGACGTGACACGGATG
CTGCTGGAAAGTCCAGATGCGGGCTTGCAATCCATACGGTCCGCCGCTCCTGGGAACTCGGTTCACAATATAGCC
GTGCAGCCGTTCCACGGAGTGCCTGACCTGGCTGCTCAATTCGAGGCCACGGCGGCTGCTATACCTACAGCGACC
GCGCTGTGCTTTTGCGAATCTCTGGCTTCTTCCGGTCCCCGAACCATCTGCATGTCCTATGAAGAGCTGAACAGA
GCTGCTAACCGAGTAGCCCGGTATCTGAGAAGCCAGGCAATCACCGTCGGTGAGGTCTTGGCTGTGCTCATGCAG
AAGTCACCCGCGTTTTATACTGTTGTTCTCGGGATTCAAAAGGCGGGATGTGCGTATCTGCCCATTCTTCCGCAG
ACCCCTGAGGCGCGGATACGCACGATCCTTGAGCAGGCTAGAGTCGAGCACTGTCTCGTGGACAATAGCTCAATT
TCGTCGTCTCTGCTGAAGGGCGTTCAGATCCATGACATGGAGCGCATTGAGTTGCAGCAATACTCATCGAAGAAT
CAAGATATCCCCTACAACGCTTCTCGACTGGCCTATGTCGTCTACACCTCGGGAACAACGGGGGTACCAAAGGGC
GTTGCTGTCACGCAGGAGAACATCGTGAGTAACATCACGGTCTTGCAATCGACATATCCCACGCCCAAGACGTCC
GAGCCGCGACTGCTTCAAGCCTGTTCTCAAGCCTTCGACGTGTCTGTCTTCGAAATCTTCTTCGCCTGGCACGCG
GGCATGTGTCTGTGTGCAGCTCCCAATGACGTCTTGTTCCAAGACCTAGAGCGTTTCATGCGACTTCTGAAGATT
AGCCACCTGAGCTTGACGCCGACGTTGGCGTCTCTTATAGAGCCCGCCAACGTACCCGAGGTCGAGTTTCTCGTC
ACGGCAGGCGAACCGATGACGATGGCCGTCTTGGACCGATGGCACGACCGGCTTTGGCAAGGTTACGGGCCATCC
GAGACGACCAACATATGCAGCGTGAAGCACATGGCGCGCGGAGACAACATTGAGCATCTCGGCTGGGCGCTTCCC
AACACTTCCTCGATCGTTATGCGGCCAGGTGCGGCCAATACTGTTCCTGTCGGATGGGTGGGCGAGCTCTGCTTC
GGCGGCCATCAGGTAGCGAGGGGATACTTGAACGATCACCGTCTGACGAGAGAAAAGTTTCTGTATGACCCGACA
TATGGGAGGATATATCGTTCCGGAGATTTGGGTCGGATGCTTCCGGACGGCTCGCTGGTGATCCTCGGACGGCTC
GATGATCAGATCAAGCTTCGAGGCCAGCGAATTGCGGCTGGTGAGATTAACAGCATAATTACCTCGACGGGTCTG
GCAACCACCGCGGTGACAATCTCGGCTCGTCGACGAACAGATGCCCCGGAACAGCTCGTGTCGTTCTTTGTGACT
TACGGGACTGGATCTGAGTACAGCACGCTGGACGTTTCTCCGGAAGTCAACCGCCATCTCTTTGCCTACTTACAG
TCTCGACTGCCACCGTATATGGTGCCGTCGTACTTGATTCCCGTATCTCAGATACCCATGACGGCAAGCGGAAAG
GTGGACCGGCGACGTCTTCGCGAGGGTTTGGAGGACTTGACCGGGGATTACGCAGAGGCCGCTTCTTCTACCACG
CAAAGTCTCGATGGCGTGAGCGACTGGACTCGTACGGAGTCAATCATCGCCGACGTCATCTCGCGATCAACAAAG
GTTCCGAGGGACGAAATCAGGCGGTGGACGCCGTTTGCGGCTCTGGGCATCGATTCAGTCACGGCCATAGAACTG
TCTCGGCTGCTGGGCTCTCGCTTGGAAACCTGGGTGTCGATATCCTTGATTCTCCAAAACCCATCCGTTGCGCAA
CTGGCCAAGTCTTTAGGGATGAGGGAAGAAGCAGGCGTCGACACTGGTACTGACAGGTCAGACGTGCTGTTGGCG
AATTTGTTTAAAGAGGTCGGCTCCGCCTTGGGCCGCGATCCGGAAGACGTCGAAGATATCCTTCCGTGTACACCC
TTGCAGGAAGCCATGCTTTCACGGGGAACGGGAAGCTATTACAACAAGATCTTGCTACGGATCCGCATTCACGCC
GATGATATGAAGGCGTACTGGGAGGAAATGTCGAGAAGACACGGGATACTCAGAACATGCTTCGTCACAACGCGC
CGCGCCGACCATCCGATTGCCCAGGTGATTCTAAGACGATGGAGGGTTCCGTGGAAGACGTACGACGTTCAGGCT
CCCTCTCTCGCTGGCGTATCCGATGAGCATCTCAAGTGTCTACCGGAGCCCCTGGACTCAGGATTGCCCCCTATT
TCCTGCGCCATCATGCGATACAAAGAGTCGACGTTCTTCTCGCTTATTTGCCACCATGCCATGTACGACGGCGTC
GCTATGGATAATCTTTGGCGAGAAATCGAGGCCCTGGCCAACCATCGCAGTCTCCCTCCCCCCGTGCCCTACAAG
CCGTTCATCAAGAAGACCGTCGACGTTCCCGCGGACACTGAGACCTTCTGGCTAGAGCAGTTTCACGGCTTCCGG
CCTTGCAGACTCTTCACGCGCTTAGCTGGTGCTCAGGCAAACCAGTGTACTCATACCAGGTCTTTTGACATGACG
TTGACTGAGGTTCAGGAGCTATGTGAAGGCCCAGATGTCGCCTTTGGTATTGTCGTGAACGGTCGCATCGCCGAC
ATGGAAGGTCTGGACCGGTTGGTCGCTCCCTGCTTCAACACAATTGCGATGCGTGTCGATGTTTCAAGCGCTTCC
CGGAACATCGACGTGGCTAGAAAGCTGCAGGATCTCAACATACGGATGATTCCGTATCAGTTCACTCCACTGCGA
AAGATCCAGAAGGTCGTTGACTGCGGACGTCGAGCGCTGTTTGACACCCTGCTTCTCCTTCAACAGCCTCTCAAA
GAGATGGACGATGGTGTCTGGACGCTGGAAGAAGATTCGGGTAATATGGATGTCCCGCTGGTGTGCGAGATTGTT
CCCTGCCCAAACCTCAACTCGATCATTCTCAACATTCACTACGATATCGGCATCGTCTCTAGGGACGTGAGTGCG
TGTCTAGCTGATGCTTTCATATACGCTTTCCGACACCTGATGGACGTGCCCTTGGCGACACCAACCGGCAAGAGT
ACTATGCCAGAGGCTCTCAGATCGGGCCTCGTGGATCTCGTCCCAAGGCGTGACAAGCCGGAAGACAAGAGCCGC
GAGCGTTCTGGAGATGAGATCTGGACTGAAACTGAGAAGAAGATACAGGCAGTCTTCTCGCAGCTTTCGGGTGTG
CCGCCGACGAAGATTGGTCGCGATACTAGCATGTTCCAGCTTGGATTGGATAGCATCAATGCTGTCCAGGTCGCT
TCGATGCTTAGACAGGAGGGATGCCGGGTTTCTGCATCTGAAGTCATGGAGTGCGCCAACTGTGCAAGTCTGGCC
CGTCGGCTTCTTGCTGCCCCAGAACAGAAGCTGCAGGAGACTGCTCAGTGTATCAGCCTGGACGGATTTGCCAAC
GACGTCTTCTCACAGACAGCCGACGCCATGTCGTCTCTTGGAGACCAGGTTAAGACAATTCTTCCGGCTACTCCG
ATGCAGTCAGCCATGCTGGCATCATTCATCTCATCAAAGGGTCACAACTATCTCAACAGGCTCGAGTTGGAGATG
AACGACGCTATCAACGTGGAGACCCTGCAGCGGGCTTTGACGGTGCTTCAGCGACGGCATCCGATGCTCCGCACC
GGCTTCGTTTCGGTGAGACACGCGGAAAGCTCGTTTGCGATGATACAATATGACGGAGTGCATGGCGGCCGGAGT
GTTGTCGAGAGCGACAATCTCAAGCGGTCACAGATTTTCGACTTGAGCGAATGGCAACAAGAAACTCGAAGAAGA
ATGCTCGAATCGCTTCATTTGCCACTCTGGAAAGCAGTTCTGGTTACGCAGGGGGATCGACTGACACTTCATCTC
ACCATGCATCACGCCCTTTACGACGCTGAATCCCTGAGGGAGCTCTTGCAAAGCCTCTCACGCCTTTTGCTAGAC
GGCAAAGAGCCCAGCTTTTCCAAAGTCGAGCCGGCTTTGAACGAGGTCCTGAACCGGGGACTTCGAGGGCAGGAG
GCTGCACAGGAGTTCTGGACCAAGCATGCGAGCAACGCCGTGGTGAACAAATTCCCATGCTTGACGCCTCTGAGA
GAAGACACGGTTGGGCTGTTGACACACGAAACAACTTCGTCCATGTCTTGCCGCTTTCTCTTCGAGGCCGCAAAG
AACTGCGGCTGCTCGATTCAGGCCTTGGTGCAAGCCGCGTGGACGCGCGTGTTGGCGTCGTATCATGGCGAGAAC
TCGGTGGTCTTTGGCATCACATTGTCTGGGCGTGTTACTGATGACACTCGGGCTGCTCCGGTTCCCTGCATCGTT
ACGATTCCGGTTGTGGCACGCAACGTGGAGTCCAACAGAGAGCTGATCGATACCATGATGGAGTTCAATGCTGAG
ATGCACAAGCATCAATTCGCTCCCCTGAGTCGCATCCAGAAGTGGCTGGGCCATCCCGCTGTACCAGTCTTCGAT
ACTCTCGTTGTGTACCAGAAAGGAGACAAGAAGAAGACGATTCGTCCACCTTGGAGGATAGTCAAGGACGAGGCG
GTTGTTGACTATGCTATCTCTCTCGAAGTCGAGCCAGATCTTGAGGATGATGATCGGATGTGCCTTCGACTCACC
TTTGCCAGAAACCTCATACCGGAGAAACAGGCTCGTCTCATTGTCCAACAGTTTGACGCCACGCTGCATCATCTG
GCTAGCGAGCCAGCCGGAAACGAAGCTGGACTCTATAGAAAGCGGCCCGAGCTCTTTGCTGTCACTCCGGCTTCG
ATGTCCGACTTGCCCGCTCCGGTGCAGTTTCTTCACGAGTTTGTGGAGAACAGCAGCAAGATCCAGCCAGAGGCG
ATAGCCCTCGAGTTCCTGGACGACTGGGATATTAAGTTGGGCCCAAAGAGATGGAGCTATAGGGAACTCGACCTC
ATGGGAAATCGAGTCGCCAACCAGCTACGGGAGCATGTCGAGCCTGGAGATATCGTGGCACTTCACTTTCAAAAA
TGTGCTGAGGCGTATTTTTCGATACTGGGCATTCTCAAAGCCGGCTGTGCGTTTGTGGCTCTGGACACCCAAGCC
CCAAAGGCGAGAAAGGACTTTATTTTGAGCGATTCTCAGGCGAGGTGTCTCTTGGCGGAAGATGGAGTTGTGATG
GATCTTGAAACTCCAATCAAGGTTCTAGGAATCGCTGAAGAATCGCTTCGAAAGCTGCCTGATCAGCGTCCGTCT
TGGGTCGACAGCAGCCTGACGCCTGGTCATACCTGCTACTGTCTCTACACGTCCGGCACGACGGGAACGCCAAAG
GGATGCGAGATCAGCCACGAGAATGCGGTTCAGGCCATGATGGCGTTTCAAGACCTGTTCAAAGGGCACTGGGAC
GCCGACTCTCGCTGGCTTCAGTTCGCGGCGCTTCATTTTGATGTCTCGGTGCTGGAGCAGTACTGGAGTTGGGCC
TTGGGCATCACAGTCGTGTCTGCGCCCCGAGACCTGATACTGGACGATCTCGCAGGGGCTATTAGAAGACTCGGT
ATCACGCACGTCGACCTTACTCCCAGCCTTGCCCGGCTGACGAGTCCGGAGGAGATGCCCAGCCTACGTGTCTTC
ATCACTGGAGGAGAGCAGCTGAAGCAGGAGATACTCGACAAATGGGGCCCGAGGGCCGTCATATATAACGCCTAC
GGTCCTACGGAGGCGACTATCGGGGTTACCACGTATCCGCGTGTGCCCGTCAACGGGAGGCCGACCAACATTGGC
AGACAGTTTCCCAATGTCGGCTCTTACGTCTTTCGACCCCTGACGGAAGCCCCCGTGCTGCGAGGCGCCGTCGGA
GAGCTGTGCGTGTCGGGAAAGCTGGTGGGCAAGGGTTATCTTCGGCGTCCGGACCTTGCTGAGGAGCGGTTCCCG
GAACTGGCAGAGTTCGGGGAGAGGGTGTACCGGACGGGCGACCTGGTTCGGATCCTCCACGATGGATGCTTCGAC
TTTCTCGGCCGGGCAGACGATCAGATCAAGCTGCGTGGACAACGGCTGGAGATGGGTGAGATTAACCATGCTATC
CGTGCAGGGGCAGCTGATGTGCTCGACTGCGCAACGCTGTTGGTGCACCGAGAGTCTCCAGGCAAGGACGTTTTG
GTGTCCTTTGTTGTCGGACGGGGATCCGGAAGCGGGCTTCAACGACTCTCTCTGCTGCGAGACGAAGAGGGACTC
GGTGCTCAGGCGAGAGCGGCGTGTCTGGGGAGGCTGCCGGCTTACATGGTGCCGACCTACTTTCTTCGGGTGTCG
TTGATACCGCTCTCGGCGAACAACAAGGTCGAAGCTAAGGAGCTCAAGGCAATGTTTCAGTCGCTTTCGCACGAG
GAGCTGATGAGGCTGTCGGCTGCGGCTGTGGCTCTTCCGAGTGGCGTCGATGAGGTTGTCATGGGCACCGTCATC
GACATCGTGGCCGAGTTCAGTGGCGTGGCAGAAGAGAGCATCACACCGTCGACCAGCTTATTCGACGTCGGCGTG
GATTCCATCAGCGCTCTACAGCTGACCGCCAGCCTTCGTCGACGAGGTTTTCAAGCTGCCTCTCCTACTCTGTTG
CTGAGGTGGCCCATCATCGCGCATCTCGTCAAAGCCCTGGCCGAAGACTCGGCGTCAGATGCGGCAAGGATGGGA
GCCAGTGCTGTGAGAGAGGCTAGACAATCTCTACAAGCCTGTCATCACAGACATCTTCCGCTCGTGTGCCGAGAG
CTCGACGTCGGGCCGGGAGACGTGGAGTACATTGCGCCATGCTCGCCGTTGCAGCAGGGCATCATCTTTAAAGCT
CTTGCCGGTGATGGTTCTGGCTCTTACTTTTCTTCTTTCGAGGTTAAGCTGAGCAGTAGAGTCTCGATTGGAAAG
TGTCGAGAAGCCTGGAGTCGGACTGTCGATGCTCACGCCATACTGAGATCCGTCTTTGTCAATACCCCTGACGGC
CATGTTCAAGCGGCGATGAAGCGAGCAGAGTGCCAATGGCAAGAGGTGAGATTCGAAACTGAAGAGGAGCTCGGT
CTCACCCTGGAATCGAAACGACGAGACTGGGTCGCGAGAAACAGGCATCACTTGTGCCACCCCATCGAGCTCATC
CAAGCAGATGGGCCAAACTCACAGAGATTGTTTCTGCATCTGTTTCACGCGCTATACGATGGCAGCAGCTTGCGA
CTCGTCAGTCAGTACGCCATGGCCCTTTACCGAGACGAGCAGCCGCTGTCTAGCCCTCCTTTCATCGAGGCGTTG
GCCCACGGACCTCTCTCGAGGCATGACGACTGCCGAAAGTTTTGGAAGAAGCACATGCACGGCTGGATGCCGTCA
CCGATGCCGACGCTCGTAGAATCATCAGAGAATCGCCGAGGCGTCATCACTCATCGCGAGGTTCCGCTTGATCGA
TTAGAGCGACTTCGTCGGCTGCAGAACGTGACGATGCAGTCTGTCGTGCTGGCGCTGTGGGCTTCAGTCCTTCAG
AGACGTTTGGCCGGTAGCGTCACAGTCGGCGTCATCCTTTCGGGCCGGTCTATCGACCTTGCTGGAGTTGAGGGC
ACCATCGGTCCTCTATTCAACACGGTGCCTCTTTTCATCGATGGACGAGAGAGGACATGGTCATCGCTGATCCGC
GAGGTCCATGCTTTCAACACTGCGGTCATGTCTTTTCAGCATGTGCCCCTGAAGGACATTCAGCGATGGTGTTCT
GAAGGTCGTCCGCTCTTCGACAATCTCTTTGCCTTTCAGCTCGAGCAACCCGGATGGTGCGACGAAGCTGCGCCG
TGGGAGCTCTACGACGGAGTGGTCCATCCCGACTATCCCCTGGCGCTGGAGGCGACGCGGACCTTGGGGGGGAAC
CTGCGGCTTTGCCTCGTCTCGCAGAGCAGCTACGCCGATGCTGATATGCTTGAGGATATGCTGAATCAGTTGGAG
AGATCCACGGAGATGGCGGAAACGGAGGAGGCCATGGCGAGTCCCTGTCAAATCCGTACCGAACACTCGCAGGTG
GCCGCAGTCGGAGAACCGGAGCAAGAAGACTTGGAGGCCGAGTTCGACTGGACGGAGGAAGCTGTCGTGGTAAGA
GAGGAGATTTCGCTGCTCGCTCGCGTGTCTCCTGAGCAAGTCGCTCCAACGACCAGGCTGCTGGAACTGGGCCTT
GACAGCATTGATGCCATGAAGCTCTCGTCGAGGCTGAGGAAGCGCGGAATCAACCTTTCTACCTCGGACGTTCTG
CGGAGCCAGACGATAGCCCGTCTTGTTGGCCAGTTGGAAACGAGAGGCGGCGGATTTTCCTCTGGACCTCAGTCT
CTGAAGGCTTTGGAAGAGATGAGGCCTAGGCTCTGGATCGAGGTGGAGAAGGCTGGGATAGAGATGAAGACTGTG
GAATCGGTTCTGCCCCCGACTCCCCTTCAAGAAGCCATGGTTGTGGGAATGGTTCAGTCAGGCTGTCGGTGGTAC
TTTAACCATGATTTCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTTAACATTGCGTGGAGAAATCTGGTT
GAGGCATCGCCATGCCTGAGGACCGGCTTCATCCAAGTCGGCGACTCGGATCTGGACATGTCGTACTGCCAGGTC
ATCTTCAAGAGCGGCAACACGGATTGCGTCAAGACGCCGACGCTGTCGGACGAGTCTGAGATGGAACAGCTGACG
CTGGAGGCGACGGGTCTCGCAGTCAGAGGCAAGGGGCTACGAGACTTGGTGCAGTTTGTGCCGGTGACGGTGAGA
GAGAGGCGTCTCGTGATCTTGTCCATGGCTCATGCTCTCTACGATGGCTGGTCACTGGGGCTCCTGAATCGCCAT
CTTGAAGCGCTTTACTGGGGTCGGACGACGGAGACGAGGGCGTCGGCCGACGGCTTTGTCGAGCGGGTGCTTGCG
TCGAGGACGGATGAGGCGCAAGCGTTCTGGACTGGTCATCTCGCGGGTCTTCGTCCGACTATGCTCAAGGGTATA
AAGACGACGATGGGAGGAGAGCCGTTGCGCAGAGAAGCCCGATCCGTCTACAGCCTCTCTCGGCTGACGAGCTTC
TGCAAGGGTCAGGCCATCAGTCTGCAGGTTCTCTGCGTCGCCGCTTGGGCTGCCGTTGCAGCAGAGCGAACCGAG
GGTCTCGACGTCGTCTTCGGGCTCGTGCTATCGGGGCGAGATGGCGAGGGGGTGGAGGATCTGGTGTTTCCAACG
ATGAGCACCGTGGCCTTGCGCTGTGTTCTTCACGGGTCTGTCTCGAGCTTCCTCGGCTATCTGGAGCAGACGGTT
GCGGAGGTCAGGGGCTATCAGCACTATCCCCTGCGAAGGGCACAGGCTGCCGGTGCCTTCAACTCGCTGTTTCTC
TTCCAGAAGGCAGCCGAGCAGGACGAGGGGTCGAGCCGGTTATTGAGGTCCGTCGACGGGCGGTCTGCTGCCGAG
TATCCGGTCTGTGTCGAGGCCGAGCCCGTCGGTCAGGGGCTCGTCTGGCGGATTGCATGCCATGATGGGCTCTTC
TCCGATGACGACGCGAAGATGCTACTTGGAAGGCTGGACCGAGTGCTGGGTTACATGATGGATAACGAGACGACC
GCTCTTCTCTCGTTTCAAGATGAGGGTGTCTCGATTTGCGGCTTACCGGCTGTGGGCATCGACGAGGAGGGGGAG
CGAGCCGTCGACTCAAGGTCTGAAGGAGCTGACATCGAGGCCAGCCAAGGGGAAGTATGGGGAGACATGGCCATG
ACGATTCGTGACGTCTTGAGCCTGGTTTCGGGCGTGGCAGTCGAGTCGATGACGCTCGGAAGCAGTCTATACCAA
CTCGGGCTCGACTCTATCAGTGCTGTCAAGGTATCGATGCTTCTGCGCAAGAGGGGCATCGGTCTGACGCCGAGG
GAGCTCATCAAGCTGCCGTCGTTGCGGGAAATGGTAGGCTACGCGAGGCTCCTAGAACAAGTTGCGGAGACGAAG
CCCCCCGGTCCGGGCTTCAGATGGACGCCTCCTCCGTCCGTGGGCGTTGAGAAGTTGATACGAGAGAGTGGCATA
TCGCCAGGTTGTGTTGAGGCCATGTTTCCGGCGACGCCGATGCAGGTCTACATGCTCACGGCGTGGGAGAAGCCT
GGAGGCGCCGTCTTCTTCCCCGAGTTTCGCTACCGGGTTGACGGCACGGACGATGTGGGCAGAGTGCGAGAGGCG
TGGGAGAAGCTCAGTGGCGAGATGGCTGTGTTGCGGACACGCTTCCTGTCTACAGGCTTGGACGTGGTGCCGTGG
GTGCAGGTTGTCATAACCAGGGAGGCCAGTCGGGAGGCGTCACAGCCCCTGGCCCGTCTGAGGATGATCAAGGCC
GTCTCGGGCCGTGGCGTTGAGTTGCGGCTCAAGATACACCACGCGCTGTACGACGGGGTCAGTCTCGAGGCGTTG
ATGGCGAGGCTGTGCGATCTCGTGAACAGGGACGGTCAAGCCGAAGACTACGAGGACGGCTTATCGCGATGGGCG
CTCTACTGCAGTGCTCTGCCAGACGGTCGAGACAGACGGCGAGAGTTCTGGACCGAGTATCTGAAGGGAGGCACA
GCCGTGGAGATTGCAGTCTCGTCGTCGGTGAAGAACATGGCCGAGAGGACGTCGTATCTTGACGAGTCGGCCATC
AAAGACATCACGTCTCTACGAACAAGGGCGTCACAGCACGACACAAGCCTCCAGGCCCTCGTCCTCGCAGCGCTG
GCCATGAGTCTCGGCAACAGCAGCATGGACACAAACCGAAGCATCATCGTGGGCATCTACCTCGCCAACCGCGCA
GGGGAAGACTGGCCTCCATCGACGTATCCGACGCTCAGCCTGGTTCCGCTGAAGATTCGGCTGGGGCCGGGGCTG
GGACTCGTCGACGTCGCTCAGGCGATTCAGGCTGACATCTTGAGCTTTGGAGAAGAGGGACGGGCGGGCGTGGGC
CTTTGGGAGATTGTGGCCTGGATGGGGCCTTCGGTCGACCTGGAGGCCTCGATCAAGGGCAAGGCGCTGGCGGTC
GGCGTCTTTGGCCCCAGCGGACGGGTATCGAGGAGTTGGGCTGCTGAGCTGGTGGCTGAGACAGCTGGGTTGCTG
AAGGAGGCTGCGAAGGATGGGGTGGAAATGGGTGAGTGA
Gene >Ophun1|6954
ATGCCGGCATCGGACAGCATCTTCCGTATCAAGCAGCTCATCGTGTCCATGGCAGCATCAGTCGGTCATGCCTCG
CATGGTCAGTGCGACTGGACGGCGGATCCATTCATGGTTCATGGCGTCATGTTGCTTCTGTTGGCGACGCTGTCG
TTGCTCGCGTCGCCGCTTCACGTGCTTGCCGCTTCTGTGCCTTCCCTTTCCACTCTCGGGCGTGGGGAAGATGGA
TGAATAAGCCGCGATGCGTCGTTACCGTCGTTACCCGATCTCGAGATTTTCTTCAAGAACCTGTCATTCTTTAAC
CGTTCGTCTCATTGCGCCTCTCACTGACTTGTTACACCAAGACTTCGTCACGGCCGCTGTCCATCAGCTCCTGAA
CCAGCTTCCGAATGCAGATCACGGCTGGACTGACTAGTCTCCAAACGCCATTAGTTGCTGGGCTTGTTCACAACC
AACTGGCGCCTCTCGCTCGATGCTCTTGGCTATAACATGCCCGTGGCCTCTCTGCGACTCCCAACTTCAGCCACC
AAGCCTAGGCTAACCCCCTACATCGAAGTATGGCGGGCTTGTCTATCATCAACCCGCGTCCTACCAGACTGTCGG
GCCCAAGCTTGCTTCATCACCTCATCGCTCCGCCATCTGACCGCTTAGCTCTTGACCAGCTGGATCGGAACGGAA
ATGGCTCCTTCACGTATCGAGAATTTCATGAGGCTGCGGCGGCAATTGCCAGCCTCCTTACTGATGCAATTCGGT
CTCCTGAGCGGAGTCGTTCTTCATTCATCGTCCCCGTCCTCGTCCCTCAGTCGTCCTTACTCTGCATCTCTTTGC
TCGCTGTTCTGAAGGCTGGCGGTGCTTTTTGCCCTCTCAATTTTGATAGCCCTCGTGAGAGAATCAGATTCATCG
TCAAAGACGTCTCCGCTACCGTTGTTCTCGTCACACGCGCCCTGGCGCATTTGGTGCCCGTCGAAGATGTTGAGA
AAGTCATCGTGGTTGATGACTTCGAACTTGGAGACCCCAGCTTGCCGACCATCGACTACCTGGAATCTGCTCCTG
AAGATCTGGCCTATGTCATGTATACATCTGGATCGACGGGGACGCCCAAAGGTGTCTGCATCTCGCATGATGCTG
TAACGCAAGCCCTCCTTGCACACGATCGTCACATCCCGGCCTTTTCAAGGTTTCTGCAGTTTGCTGCACCCACAT
TTGACGTCTCAGTCTTCGAGATCTTCTTCCCCCTTTTCCGCGGCAGCACTCTGGTTACAGCAAGCCGCGATGAGC
TGCTGGATGATCTGCCCGCAGTTCTACGGAGGACGAAGGTCGACGCCTGCGAGTTGACACCCACGGTCGCTGCGA
GCCTGCTCCGAAGACGCCAAAATGCCCCTGCCCTGAAGCTTCTTCTGACCATTGGCGAGATGCTGACCCTTCCCG
TCGTCGAGGAGTTTGGCGGGTCGGAAACCAGACCTAGCATGCTATGGGCCATGTATGGACCGACAGAGGCCACCA
TTCATTGGTGAGTCTTGACTATAGCTGAAATGCCATGATTGGCTGCCTCTTGGGTTTTAACATTGTTCACAGCAC
GCTGCAGGCCGCCTTGCCGTCCAACTCACCAGTAAGAAACATTGGAATTCCTCTTGATACAGTATCCTGCTTCGT
CGTGGATGCTCGTGTCTCTGCTCAAGGAGGAAGCGACGTCAGGGTTCTCCCACGAGGCCAAATCGGAGAACTGGC
TGTCGGCGGTTACCAGTTGGCCAGCGGTTATCTCAATCGTCCGGAGCAAACTGCATCTGCCTTCATAACCACACC
GTACGGCCGACTTTACCTGACAGGAGACCGAGCTCGGATGACGCCTGATGGAATGCTCGAGTGTCTTGGTCGCTT
GACGGGTGGACAATTGAAGCTGCGTGGCCAGCGCATCGAGACTGGCGAGGTCGAGCAGTCGGCTCTCAGAGCTTC
TGGCTGCCACGGCGCCGTAGCAGCTGTCATTGACGCCAATCTGGTTCTGTTCTGCGCCGTTGATCCCGGCACGTC
CGAGGATGACATTGCCACCTGCTGCAAGAGCTGGTTGCCTCGCTTCATGGTGCCCGGGGAGATTGTCTTAATGGC
CGAGTTCCCTTGCTTGCCAAGTGGCAAGGTTGACAAGCCGAAGCTGAAGTCATTACATCAAGAGCAGAAGTCGAC
CGAACCGTCTGAATACGATGAGAACTTACTGGCTGAGGAGCACGAGGTTGTTCGTGTCATTTCGTCAGTCCTGGG
TCGACGAGTAAACAGGCAGATGCCTCTGCCCTTAGCCGGCGTAGATTCGCTTTCAGCAATCAAGCTGGCATCTGC
GCTGCGAGTCTCGGGCTTCAGGATGGAAGTTTCGGATCTGCTGAGCCTGAAAACAGTAGCAGACCTTTGCTGCCA
GATCCGCAAATCGCCCATGGTGAAGCCATCAAATCAACAACCTTGTGTGAGCATCCTTGCGGACTTGGACACCAT
TCTGGCTCAGCATCCCGGACTGAACCTGAAGAAAGAGAACATCAATGATGTTATCTCATGCACTCCACTTCAAAC
GGCCTTGCTAGCCGAGACAGCGAGGGACCCCCTTCTCTATTGCAACCAAGTCGAGTTTGAAGTGGCTCCGGGGTT
TACAATTCAAGAAGTCTCGGCTGCAATCTGCCGAGTTGCAGCGGATAACGAAGCCCTCCGCTCAGGCTTTGTCGA
GGCTCGTGGCGGGTATGCTGCCATCGTGTTCAGGACGTTTGGGACCGACGACAACCTCCGCGTCGTGTCTCACTT
CGACGAGAGCTTCTCTTTCAAGGAACCAGGCGACTTTCTCAGACCATTTCGCGTCCAGATCCGGGGCCTTGATGT
CCGACTGAGAGTTCTTTTTCAGGTTCACCACGCAGTTTACGATGGGTGGTCCATGGATCTGATCTTGTCTGACCT
GTCTGCGCTGCTCAGGCGTCAGCCACTTTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGTCATCACCTGAGAGA
CTCCAAGGATGCCGATGAAGAATTGGCCATGAAATTTTGGGGCGAGTATTTGGCGGGTTGGAACAAGTCTTCTTT
TCCGAAGCTGGCTGCACGACTTCAAATGTCGAATGTGATCAAGAAAACGAGCTGTACGTTTCAGATACTGCCCGA
TTCCGTTAGAAAACTGGCAGGAGAGCGGGCGATAGGCGCCCAAGTACTCTTCCAAGCTTCTCTGGCTTTGCTCTG
GAGCGGCATTGCGGGAGATCAGGACCTGGTGCTTGGATCGGTGACGTCCGGACGGACGATACCCGTGGACCAGAT
TGAGGAAATTCTTGGCCCTTGCTTTGCGTCTCTGCCTGTCCGAATCGATCTGAGCGACATGGTATCCGGCAAGGA
CTTGCTGACGAGCATCCAAGCAAGCAATCGGGCGATGATGCAGCACTGCACATTGCCCCTTTCAGGAATTCGGAC
TTTGGCAGGGCTTCAGCCAGCCGAGAGCCTGTACGATGTTTTGCTTGTCTACCAAGAGTCTCTAGAGAGTCTGAA
CAGAAAAGACTGGCTCTTTGCAGAAGTAAACCACCTGGATCGGCTCGAGACGAAGCTGTTGCTCGAGATACAGCC
TCACGAGACATTCTACTCGATACATGCTACTTACCATTCGTCTTTCTTTGCTCCAGGATTGGTTGACTGTCTCCT
TCAGCAGCTCGAGGACGTGACACGGATGCTGCTGGAAAGTCCAGATGCGGGCTTGCAATCCATACGGTCCGCCGC
TCCTGGGAACTCGGTTCACAATATAGCCGTGCAGCCGTTCCACGGAGTGCCTGACCTGGCTGCTCAATTCGAGGC
CACGGCGGCTGCTATACCTACAGCGACCGCGCTGTGCTTTTGCGAATCTCTGGCTTCTTCCGGTCCCCGAACCAT
CTGCATGTCCTATGAAGAGCTGAACAGAGCTGCTAACCGAGTAGCCCGGTATCTGAGAAGCCAGGCAATCACCGT
CGGTGAGGTCTTGGCTGTGCTCATGCAGAAGTCACCCGCGTTTTATACTGTTGTTCTCGGGATTCAAAAGGCGGG
ATGTGCGTATCTGCCCATTCTTCCGCAGACCCCTGAGGCGCGGATACGCACGATCCTTGAGCAGGCTAGAGTCGA
GCACTGTCTCGTGGACAATAGCTCAATTTCGTCGTCTCTGCTGAAGGGCGTTCAGATCCATGACATGGAGCGCAT
TGAGTTGCAGCAATACTCATCGAAGAATCAAGATATCCCCTACAACGCTTCTCGACTGGCCTATGTCGTCTACAC
CTCGGGAACAACGGGGGTACCAAAGGGCGTTGCTGTCACGCAGGAGAACATCGTGAGTAACATCACGGTCTTGCA
ATCGACATATCCCACGCCCAAGACGTCCGAGCCGCGACTGCTTCAAGCCTGTTCTCAAGCCTTCGACGTGTCTGT
CTTCGAAATCTTCTTCGCCTGGCACGCGGGCATGTGTCTGTGTGCAGCTCCCAATGACGTCTTGTTCCAAGACCT
AGAGCGTTTCATGCGACTTCTGAAGATTAGCCACCTGAGCTTGACGCCGACGTTGGCGTCTCTTATAGAGCCCGC
CAACGTACCCGAGGTCGAGTTTCTCGTCACGGCAGGCGAACCGATGACGATGGCCGTCTTGGACCGATGGCACGA
CCGGCTTTGGCAAGGTTACGGGCCATCCGAGACGACCAACATATGCAGCGTGAAGCACATGGCGCGCGGAGACAA
CATTGAGCATCTCGGCTGGGCGCTTCCCAACACTTCCTCGATCGTTATGCGGCCAGGTGCGGCCAATACTGTTCC
TGTCGGATGGGTGGGCGAGCTCTGCTTCGGCGGCCATCAGGTAGCGAGGGGATACTTGAACGATCACCGTCTGAC
GAGAGAAAAGTTTCTGTATGACCCGACATATGGGAGGATATATCGTTCCGGAGATTTGGGTCGGATGCTTCCGGA
CGGCTCGCTGGTGATCCTCGGACGGCTCGATGATCAGATCAAGCTTCGAGGCCAGCGAATTGCGGCTGGTGAGAT
TAACAGCATAATTACCTCGACGGGTCTGGCAACCACCGCGGTGACAATCTCGGCTCGTCGACGAACAGATGCCCC
GGAACAGCTCGTGTCGTTCTTTGTGACTTACGGGACTGGATCTGAGTACAGCACGCTGGACGTTTCTCCGGAAGT
CAACCGCCATCTCTTTGCCTACTTACAGTCTCGACTGCCACCGTATATGGTGCCGTCGTACTTGATTCCCGTATC
TCAGATACCCATGACGGCAAGCGGAAAGGTGGACCGGCGACGTCTTCGCGAGGGTTTGGAGGACTTGACCGGGGA
TTACGCAGAGGCCGCTTCTTCTACCACGCAAAGTCTCGATGGCGTGAGCGACTGGACTCGTACGGAGTCAATCAT
CGCCGACGTCATCTCGCGATCAACAAAGGTTCCGAGGGACGAAATCAGGCGGTGGACGCCGTTTGCGGCTCTGGG
CATCGATTCAGTCACGGCCATAGAACTGTCTCGGCTGCTGGGCTCTCGCTTGGAAACCTGGGTGTCGATATCCTT
GATTCTCCAAAACCCATCCGTTGCGCAACTGGCCAAGTCTTTAGGGATGAGGGAAGAAGCAGGCGTCGACACTGG
TACTGACAGGTCAGACGTGCTGTTGGCGAATTTGTTTAAAGAGGTCGGCTCCGCCTTGGGCCGCGATCCGGAAGA
CGTCGAAGATATCCTTCCGTGTACACCCTTGCAGGAAGCCATGCTTTCACGGGGAACGGGAAGCTATTACAACAA
GATCTTGCTACGGATCCGCATTCACGCCGATGATATGAAGGCGTACTGGGAGGAAATGTCGAGAAGACACGGGAT
ACTCAGAACATGCTTCGTCACAACGCGCCGCGCCGACCATCCGATTGCCCAGGTGATTCTAAGACGATGGAGGGT
TCCGTGGAAGACGTACGACGTTCAGGCTCCCTCTCTCGCTGGCGTATCCGATGAGCATCTCAAGTGTCTACCGGA
GCCCCTGGACTCAGGATTGCCCCCTATTTCCTGCGCCATCATGCGATACAAAGAGTCGACGTTCTTCTCGCTTAT
TTGCCACCATGCCATGTACGACGGCGTCGCTATGGATAATCTTTGGCGAGAAATCGAGGCCCTGGCCAACCATCG
CAGTCTCCCTCCCCCCGTGCCCTACAAGCCGTTCATCAAGAAGACCGTCGACGTTCCCGCGGACACTGAGACCTT
CTGGCTAGAGCAGTTTCACGGCTTCCGGCCTTGCAGACTCTTCACGCGCTTAGCTGGTGCTCAGGCAAACCAGTG
TACTCATACCAGGTCTTTTGACATGACGTTGACTGAGGTTCAGGAGCGTTTGAGAGGGCTTGGACTGTCTCTGCT
TTCTGCATGTCAAACAGCTTGGGCGACTCTTCTCTCGACAGTATGTGAAGGCCCAGATGTCGCCTTTGGTATTGT
CGTGAACGGTCGCATCGCCGACATGGAAGGTCTGGACCGGTTGGTCGCTCCCTGCTTCAACACAATTGCGATGCG
TGTCGATGTTTCAAGCGCTTCCCGGAACATCGACGTGGCTAGAAAGCTGCAGGATCTCAACATACGGATGATTCC
GTATCAGTTCACTCCACTGCGAAAGATCCAGAAGGTCGTTGACTGCGGACGTCGAGCGCTGTTTGACACCCTGCT
TCTCCTTCAACAGCCTCTCAAAGAGATGGACGATGGTGTCTGGACGCTGGAAGAAGATTCGGGTAATATGGATGT
CCCGCTGGTGTGCGAGATTGTTCCCTGCCCAAACCTCAACTCGATCATTCTCAACATTCACTACGATATCGGCAT
CGTCTCTAGGGACGTGAGTGCGTGTCTAGCTGATGCTTTCATATACGCTTTCCGACACCTGATGGACGTGCCCTT
GGCGACACCAACCGGCAAGAGTACTATGCCAGAGGCTCTCAGATCGGGCCTCGTGGATCTCGTCCCAAGGCGTGA
CAAGCCGGAAGACAAGAGCCGCGAGCGTTCTGGAGATGAGATCTGGACTGAAACTGAGAAGAAGATACAGGCAGT
CTTCTCGCAGCTTTCGGGTGTGCCGCCGACGAAGATTGGTCGCGATACTAGCATGTTCCAGCTTGGATTGGATAG
CATCAATGCTGTCCAGGTCGCTTCGATGCTTAGACAGGAGGGATGCCGGGTTTCTGCATCTGAAGTCATGGAGTG
CGCCAACTGTGCAAGTCTGGCCCGTCGGCTTCTTGCTGCCCCAGAACAGAAGCTGCAGGAGACTGCTCAGTGTAT
CAGCCTGGACGGATTTGCCAACGACGTCTTCTCACAGACAGCCGACGCCATGTCGTCTCTTGGAGACCAGGTTAA
GACAATTCTTCCGGCTACTCCGATGCAGTCAGCCATGCTGGCATCATTCATCTCATCAAAGGGTCACAACTATCT
CAACAGGCTCGAGTTGGAGATGAACGACGCTATCAACGTGGAGACCCTGCAGCGGGCTTTGACGGTGCTTCAGCG
ACGGCATCCGATGCTCCGCACCGGCTTCGTTTCGGTGAGACACGCGGAAAGCTCGTTTGCGATGATACAATATGA
CGGAGTGCATGGCGGCCGGAGTGTTGTCGAGAGCGACAATCTCAAGCGGTCACAGATTTTCGACTTGAGCGAATG
GCAACAAGAAACTCGAAGAAGAATGCTCGAATCGCTTCATTTGCCACTCTGGAAAGCAGTTCTGGTTACGCAGGG
GGATCGACTGACACTTCATCTCACCATGCATCACGCCCTTTACGACGCTGAATCCCTGAGGGAGCTCTTGCAAAG
CCTCTCACGCCTTTTGCTAGACGGCAAAGAGCCCAGCTTTTCCAAAGTCGAGCCGGCTTTGAACGAGGTCCTGAA
CCGGGGACTTCGAGGGCAGGAGGCTGCACAGGAGTTCTGGACCAAGCATGCGAGCAACGCCGTGGTGAACAAATT
CCCATGCTTGACGCCTCTGAGAGAAGACACGGTTGGGCTGTTGACACACGAAACAACTTCGTCCATGTCTTGCCG
CTTTCTCTTCGAGGCCGCAAAGAACTGCGGCTGCTCGATTCAGGCCTTGGTGCAAGCCGCGTGGACGCGCGTGTT
GGCGTCGTATCATGGCGAGAACTCGGTGGTCTTTGGCATCACATTGTCTGGGCGTGTTACTGATGACACTCGGGC
TGCTCCGGTTCCCTGCATCGTTACGATTCCGGTTGTGGCACGCAACGTGGAGTCCAACAGAGAGCTGATCGATAC
CATGATGGAGTTCAATGCTGAGATGCACAAGCATCAATTCGCTCCCCTGAGTCGCATCCAGAAGTGGCTGGGCCA
TCCCGCTGTACCAGTCTTCGATACTCTCGTTGTGTACCAGAAAGGAGACAAGAAGAAGACGATTCGTCCACCTTG
GAGGATAGTCAAGGACGAGGCGGTTGTTGACTATGCTATCTCTCTCGAAGTCGAGCCAGATCTTGAGGATGATGA
TCGGATGTGCCTTCGACTCACCTTTGCCAGAAACCTCATACCGGAGAAACAGGCTCGTCTCATTGTCCAACAGTT
TGACGCCACGCTGCATCATCTGGCTAGCGAGCCAGCCGGAAACGAAGCTGGACTCTATAGAAAGCGGCCCGAGCT
CTTTGCTGTCACTCCGGCTTCGATGTCCGACTTGCCCGCTCCGGTGCAGTTTCTTCACGAGTTTGTGGAGAACAG
CAGCAAGATCCAGCCAGAGGCGATAGCCCTCGAGTTCCTGGACGACTGGGATATTAAGTTGGGCCCAAAGAGATG
GAGCTATAGGGAACTCGACCTCATGGGAAATCGAGTCGCCAACCAGCTACGGGAGCATGTCGAGCCTGGAGATAT
CGTGGCACTTCACTTTCAAAAATGTGCTGAGGCGTATTTTTCGATACTGGGCATTCTCAAAGCCGGCTGTGCGTT
TGTGGCTCTGGACACCCAAGCCCCAAAGGCGAGAAAGGACTTTATTTTGAGCGATTCTCAGGCGAGGTGTCTCTT
GGCGGAAGATGGAGTTGTGATGGATCTTGAAACTCCAATCAAGGTTCTAGGAATCGCTGAAGAATCGCTTCGAAA
GCTGCCTGATCAGCGTCCGTCTTGGGTCGACAGCAGCCTGACGCCTGGTCATACCTGCTACTGTCTCTACACGTC
CGGCACGACGGGAACGCCAAAGGGATGCGAGATCAGCCACGAGAATGCGGTTCAGGCCATGATGGCGTTTCAAGA
CCTGTTCAAAGGGCACTGGGACGCCGACTCTCGCTGGCTTCAGTTCGCGGCGCTTCATTTTGATGTCTCGGTGCT
GGAGCAGTACTGGAGTTGGGCCTTGGGCATCACAGTCGTGTCTGCGCCCCGAGACCTGATACTGGACGATCTCGC
AGGGGCTATTAGAAGACTCGGTATCACGCACGTCGACCTTACTCCCAGCCTTGCCCGGCTGACGAGTCCGGAGGA
GATGCCCAGCCTACGTGTCTTCATCACTGGAGGAGAGCAGCTGAAGCAGGAGATACTCGACAAATGGGGCCCGAG
GGCCGTCATATATAACGCCTACGGTCCTACGGAGGCGACTATCGGGGTTACCACGTATCCGCGTGTGCCCGTCAA
CGGGAGGCCGACCAACATTGGCAGACAGTTTCCCAATGTCGGCTCTTACGTCTTTCGACCCCTGACGGAAGCCCC
CGTGCTGCGAGGCGCCGTCGGAGAGCTGTGCGTGTCGGGAAAGCTGGTGGGCAAGGGTTATCTTCGGCGTCCGGA
CCTTGCTGAGGAGCGGTTCCCGGAACTGGCAGAGTTCGGGGAGAGGGTGTACCGGACGGGCGACCTGGTTCGGAT
CCTCCACGATGGATGCTTCGACTTTCTCGGCCGGGCAGACGATCAGATCAAGCTGCGTGGACAACGGCTGGAGAT
GGGTGAGATTAACCATGCTATCCGTGCAGGGGCAGCTGATGTGCTCGACTGCGCAACGCTGTTGGTGCACCGAGA
GTCTCCAGGCAAGGACGTTTTGGTGTCCTTTGTTGTCGGACGGGGATCCGGAAGCGGGCTTCAACGACTCTCTCT
GCTGCGAGACGAAGAGGGACTCGGTGCTCAGGCGAGAGCGGCGTGTCTGGGGAGGCTGCCGGCTTACATGGTGCC
GACCTACTTTCTTCGGGTGTCGTTGATACCGCTCTCGGCGAACAACAAGGTCGAAGCTAAGGAGCTCAAGGCAAT
GTTTCAGTCGCTTTCGCACGAGGAGCTGATGAGGCTGTCGGCTGCGGCTGTGGCTCTTCCGAGTGGCGTCGATGA
GGTTGTCATGGGCACCGTCATCGACATCGTGGCCGAGTTCAGTGGCGTGGCAGAAGAGAGCATCACACCGTCGAC
CAGCTTATTCGACGTCGGCGTGGATTCCATCAGCGCTCTACAGCTGACCGCCAGCCTTCGTCGACGAGGTTTTCA
AGCTGCCTCTCCTACTCTGTTGCTGAGGTGGCCCATCATCGCGCATCTCGTCAAAGCCCTGGCCGAAGACTCGGC
GTCAGATGCGGCAAGGATGGGAGCCAGTGCTGTGAGAGAGGCTAGACAATCTCTACAAGCCTGTCATCACAGACA
TCTTCCGCTCGTGTGCCGAGAGCTCGACGTCGGGCCGGGAGACGTGGAGTACATTGCGCCATGCTCGCCGTTGCA
GCAGGGCATCATCTTTAAAGCTCTTGCCGGTGATGGTTCTGGCTCTTACTTTTCTTCTTTCGAGGTTAAGCTGAG
CAGTAGAGTCTCGATTGGAAAGTGTCGAGAAGCCTGGAGTCGGACTGTCGATGCTCACGCCATACTGAGATCCGT
CTTTGTCAATACCCCTGACGGCCATGTTCAAGCGGCGATGAAGCGAGCAGAGTGCCAATGGCAAGAGGTGAGATT
CGAAACTGAAGAGGAGCTCGGTCTCACCCTGGAATCGAAACGACGAGACTGGGTCGCGAGAAACAGGCATCACTT
GTGCCACCCCATCGAGCTCATCCAAGCAGATGGGCCAAACTCACAGAGATTGTTTCTGCATCTGTTTCACGCGCT
ATACGATGGCAGCAGCTTGCGACTCGTCAGTCAGTACGCCATGGCCCTTTACCGAGACGAGCAGCCGCTGTCTAG
CCCTCCTTTCATCGAGGCGTTGGCCCACGGACCTCTCTCGAGGCATGACGACTGCCGAAAGTTTTGGAAGAAGCA
CATGCACGGCTGGATGCCGTCACCGATGCCGACGCTCGTAGAATCATCAGAGAATCGCCGAGGCGTCATCACTCA
TCGCGAGGTTCCGCTTGATCGATTAGAGCGACTTCGTCGGCTGCAGAACGTGACGATGCAGTCTGTCGTGCTGGC
GCTGTGGGCTTCAGTCCTTCAGAGACGTTTGGCCGGTAGCGTCACAGTCGGCGTCATCCTTTCGGGCCGGTCTAT
CGACCTTGCTGGAGTTGAGGGCACCATCGGTCCTCTATTCAACACGGTGCCTCTTTTCATCGATGGACGAGAGAG
GACATGGTCATCGCTGATCCGCGAGGTCCATGCTTTCAACACTGCGGTCATGTCTTTTCAGCATGTGCCCCTGAA
GGACATTCAGCGATGGTGTTCTGAAGGTCGTCCGCTCTTCGACAATCTCTTTGCCTTTCAGCTCGAGCAACCCGG
ATGGTGCGACGAAGCTGCGCCGTGGGAGCTCTACGACGGAGTGGTCCATCCCGACTATCCCCTGGCGCTGGAGGC
GACGCGGACCTTGGGGGGGAACCTGCGGCTTTGCCTCGTCTCGCAGAGCAGCTACGCCGATGCTGATATGCTTGA
GGATATGCTGAATCAGTTGGAGAGATCCACGGAGATGGCGGAAACGGAGGAGGCCATGGCGAGTCCCTGTCAAAT
CCGTACCGAACACTCGCAGGTGGCCGCAGTCGGAGAACCGGAGCAAGAAGACTTGGAGGCCGAGTTCGACTGGAC
GGAGGAAGCTGTCGTGGTAAGAGAGGAGATTTCGCTGCTCGCTCGCGTGTCTCCTGAGCAAGTCGCTCCAACGAC
CAGGCTGCTGGAACTGGGCCTTGACAGCATTGATGCCATGAAGCTCTCGTCGAGGCTGAGGAAGCGCGGAATCAA
CCTTTCTACCTCGGACGTTCTGCGGAGCCAGACGATAGCCCGTCTTGTTGGCCAGTTGGAAACGAGAGGCGGCGG
ATTTTCCTCTGGACCTCAGTCTCTGAAGGCTTTGGAAGAGATGAGGCCTAGGCTCTGGATCGAGGTGGAGAAGGC
TGGGATAGAGATGAAGACTGTGGAATCGGTTCTGCCCCCGACTCCCCTTCAAGAAGCCATGGTTGTGGGAATGGT
TCAGTCAGGCTGTCGGTGGTACTTTAACCATGATTTCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTTAA
CATTGCGTGGAGAAATCTGGTTGAGGCATCGCCATGCCTGAGGACCGGCTTCATCCAAGTCGGCGACTCGGATCT
GGACATGTCGTACTGCCAGGTCATCTTCAAGAGCGGCAACACGGATTGCGTCAAGACGCCGACGCTGTCGGACGA
GTCTGAGATGGAACAGCTGACGCTGGAGGCGACGGGTCTCGCAGTCAGAGGCAAGGGGCTACGAGACTTGGTGCA
GTTTGTGCCGGTGACGGTGAGAGAGAGGCGTCTCGTGATCTTGTCCATGGCTCATGCTCTCTACGATGGCTGGTC
ACTGGGGCTCCTGAATCGCCATCTTGAAGCGCTTTACTGGGGTCGGACGACGGAGACGAGGGCGTCGGCCGACGG
CTTTGTCGAGCGGGTGCTTGCGTCGAGGACGGATGAGGCGCAAGCGTTCTGGACTGGTCATCTCGCGGGTCTTCG
TCCGACTATGCTCAAGGGTATAAAGACGACGATGGGAGGAGAGCCGTTGCGCAGAGAAGCCCGATCCGTCTACAG
CCTCTCTCGGCTGACGAGCTTCTGCAAGGGTCAGGCCATCAGTCTGCAGGTTCTCTGCGTCGCCGCTTGGGCTGC
CGTTGCAGCAGAGCGAACCGAGGGTCTCGACGTCGTCTTCGGGCTCGTGCTATCGGGGCGAGATGGCGAGGGGGT
GGAGGATCTGGTGTTTCCAACGATGAGCACCGTGGCCTTGCGCTGTGTTCTTCACGGGTCTGTCTCGAGCTTCCT
CGGCTATCTGGAGCAGACGGTTGCGGAGGTCAGGGGCTATCAGCACTATCCCCTGCGAAGGGCACAGGCTGCCGG
TGCCTTCAACTCGCTGTTTCTCTTCCAGAAGGCAGCCGAGCAGGACGAGGGGTCGAGCCGGTTATTGAGGTCCGT
CGACGGGCGGTCTGCTGCCGAGTATCCGGTCTGTGTCGAGGCCGAGCCCGTCGGTCAGGGGCTCGTCTGGCGGAT
TGCATGCCATGATGGGCTCTTCTCCGATGACGACGCGAAGATGCTACTTGGAAGGCTGGACCGAGTGCTGGGTTA
CATGATGGATAACGAGACGACCGCTCTTCTCTCGTTTCAAGATGAGGGTGTCTCGATTTGCGGCTTACCGGCTGT
GGGCATCGACGAGGAGGGGGAGCGAGCCGTCGACTCAAGGTCTGAAGGAGCTGACATCGAGGCCAGCCAAGGGGA
AGTATGGGGAGACATGGCCATGACGATTCGTGACGTCTTGAGCCTGGTTTCGGGCGTGGCAGTCGAGTCGATGAC
GCTCGGAAGCAGTCTATACCAACTCGGGCTCGACTCTATCAGTGCTGTCAAGGTATCGATGCTTCTGCGCAAGAG
GGGCATCGGTCTGACGCCGAGGGAGCTCATCAAGCTGCCGTCGTTGCGGGAAATGGTAGGCTACGCGAGGCTCCT
AGAACAAGTTGCGGAGACGAAGCCCCCCGGTCCGGGCTTCAGATGGACGCCTCCTCCGTCCGTGGGCGTTGAGAA
GTTGATACGAGAGAGTGGCATATCGCCAGGTTGTGTTGAGGCCATGTTTCCGGCGACGCCGATGCAGGTCTACAT
GCTCACGGCGTGGGAGAAGCCTGGAGGCGCCGTCTTCTTCCCCGAGTTTCGCTACCGGGTTGACGGCACGGACGA
TGTGGGCAGAGTGCGAGAGGCGTGGGAGAAGCTCAGTGGCGAGATGGCTGTGTTGCGGACACGCTTCCTGTCTAC
AGGCTTGGACGTGGTGCCGTGGGTGCAGGTTGTCATAACCAGGGAGGCCAGTCGGGAGGCGTCACAGCCCCTGGC
CCGTCTGAGGATGATCAAGGCCGTCTCGGGCCGTGGCGTTGAGTTGCGGCTCAAGATACACCACGCGCTGTACGA
CGGGGTCAGTCTCGAGGCGTTGATGGCGAGGCTGTGCGATCTCGTGAACAGGGACGGTCAAGCCGAAGACTACGA
GGACGGCTTATCGCGATGGGCGCTCTACTGCAGTGCTCTGCCAGACGGTCGAGACAGACGGCGAGAGTTCTGGAC
CGAGTATCTGAAGGGAGGCACAGCCGTGGAGATTGCAGTCTCGTCGTCGGTGAAGAACATGGCCGAGAGGACGTC
GTATCTTGACGAGTCGGCCATCAAAGACATCACGTCTCTACGAACAAGGGCGTCACAGCACGACACAAGCCTCCA
GGCCCTCGTCCTCGCAGCGCTGGCCATGAGTCTCGGCAACAGCAGCATGGACACAAACCGAAGCATCATCGTGGG
CATCTACCTCGCCAACCGCGCAGGGGAAGACTGGCCTCCATCGACGTATCCGACGCTCAGCCTGGTTCCGCTGAA
GATTCGGCTGGGGCCGGGGCTGGGACTCGTCGACGTCGCTCAGGCGATTCAGGCTGACATCTTGAGCTTTGGAGA
AGAGGGACGGGCGGGCGTGGGCCTTTGGGAGATTGTGGCCTGGATGGGGGTACGGATCGGTTGCTTTATTAATTT
CGTTGTTGATGGTGGAGCAGACAGCAGGGGAGGGGGGGAGGTGTCGATGGTGAGGTGCTTGGGAGAAGAGGAAGA
TGATGTGGGAGACGAAGAGGGCTTAGAGGGATGGACTGATGGGATGAGGAAGAACGTGGTTAGAGATGCGGTCGA
GGTCAGTCTTCCTTTCGTTTCTTACATCTGCTCTCCTGTTGAGAAGCAGAGCGGCTAACGTGACAAATCTCTAGC
CTTCGGTCGACCTGGAGGCCTCGATCAAGGGCAAGGCGCTGGCGGTCGGCGTCTTTGGCCCCAGCGGACGGGTAT
CGAGGAGTTGGGCTGCTGAGCTGGTGGCTGAGACAGCTGGGTTGCTGAAGGAGGCTGCGAAGGATGGGGTGGAAA
TGGGTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail