Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6951
Gene name
LocationContig_81:16393..17554
Strand-
Gene length (bp)1161
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 2.0E-26 112 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 28 270 3.0E-47
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 43 298 2.0E-41
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 42 272 2.0E-32
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 42 271 4.0E-32
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 42 271 5.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 28 270 3.0E-47
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 43 298 2.0E-41
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 42 272 2.0E-32
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 42 271 4.0E-32
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 42 271 5.0E-32
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 46 272 6.0E-32
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 57 313 4.0E-31
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 43 262 5.0E-30
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 74 294 6.0E-30
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 5 261 4.0E-29
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 20 261 1.0E-26
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 81 271 8.0E-24
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 32 263 1.0E-18
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 34 263 4.0E-18
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 105 277 3.0E-14
sp|O88956|PLPP1_CAVPO Phospholipid phosphatase 1 OS=Cavia porcellus GN=PLPP1 PE=2 SV=1 39 252 2.0E-13
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 39 254 1.0E-12
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 39 252 2.0E-11
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 21 252 1.0E-10
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 57 252 5.0E-10
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 57 252 7.0E-10
sp|O14494|PLPP1_HUMAN Phospholipid phosphatase 1 OS=Homo sapiens GN=PLPP1 PE=1 SV=1 39 252 3.0E-09
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 115 248 1.0E-08
sp|Q7TMB7|LPPR4_RAT Lipid phosphate phosphatase-related protein type 4 OS=Rattus norvegicus GN=Lppr4 PE=1 SV=1 53 254 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 42 61 19
2 81 103 22
3 110 129 19
4 183 202 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6951
MAPSPSNPPPTTDERAVEASRAWYDAIQHVPQDTTYMSDYAGLALLGIGLGLLATFVTPFHRMFSVNDLAISFPH
AEHERVPTFWAIIAALVFPLLVFVCHGCRFGHSQALYLSFSVAIMLTGFLTEVVKDAVGRPRPDLLARCRLKKDA
KLEGLVTIEVCDLPHDRKLHEGWRSFPSGHSSFSFAGLGFLSLFFAGQLHLFSQAGNRDLCRTLLCLSPLIGAML
IAISRCEDYRHDVYDVCSGSALGMFIAYWSYRRHWPKLSSPKCDVPLPPPGSDTQAWQRIGDEEMGDPGSERGYE
LGNLARTRSRQPR*
Coding >Ophun1|6951
ATGGCCCCATCCCCCTCCAATCCTCCTCCGACCACAGACGAGCGCGCCGTGGAGGCGTCCCGGGCGTGGTACGAT
GCCATCCAGCACGTACCCCAGGACACGACTTACATGTCCGACTACGCCGGCTTGGCTCTTCTGGGGATTGGACTG
GGCCTCTTAGCTACCTTCGTTACACCATTTCACCGTATGTTCTCCGTCAACGATCTTGCCATCTCCTTTCCTCAC
GCCGAGCACGAGCGCGTCCCTACTTTCTGGGCCATCATTGCCGCCCTGGTATTCCCGCTACTCGTCTTCGTCTGC
CACGGCTGCCGATTCGGGCACTCGCAAGCCCTATACCTGTCCTTCTCAGTCGCCATCATGCTCACGGGCTTCCTC
ACCGAGGTCGTCAAGGATGCGGTTGGCAGGCCTCGCCCCGACTTACTGGCTCGCTGCAGGCTGAAAAAGGACGCC
AAGCTGGAAGGTCTCGTCACTATAGAAGTATGCGACCTGCCGCACGATCGCAAGTTGCACGAAGGCTGGCGCTCC
TTTCCTTCCGGACACTCTTCCTTCTCCTTCGCCGGCCTCGGCTTCTTGAGTCTCTTCTTCGCCGGCCAGCTGCAC
CTATTTAGCCAGGCCGGGAATCGGGACCTCTGTCGTACACTGCTTTGCCTGAGCCCCCTCATCGGCGCCATGCTC
ATTGCCATCTCGCGATGCGAAGACTATCGTCACGACGTCTATGACGTCTGCAGCGGTTCCGCGCTGGGCATGTTC
ATCGCCTACTGGAGCTATCGAAGGCATTGGCCCAAGCTCTCTAGTCCCAAGTGTGACGTCCCCTTACCGCCACCC
GGTTCTGATACGCAAGCGTGGCAACGGATCGGGGATGAGGAAATGGGTGACCCCGGCTCGGAGCGTGGCTACGAA
TTGGGGAACCTGGCCAGAACGCGCTCCAGACAGCCGAGATAA
Transcript >Ophun1|6951
ATGGCCCCATCCCCCTCCAATCCTCCTCCGACCACAGACGAGCGCGCCGTGGAGGCGTCCCGGGCGTGGTACGAT
GCCATCCAGCACGTACCCCAGGACACGACTTACATGTCCGACTACGCCGGCTTGGCTCTTCTGGGGATTGGACTG
GGCCTCTTAGCTACCTTCGTTACACCATTTCACCGTATGTTCTCCGTCAACGATCTTGCCATCTCCTTTCCTCAC
GCCGAGCACGAGCGCGTCCCTACTTTCTGGGCCATCATTGCCGCCCTGGTATTCCCGCTACTCGTCTTCGTCTGC
CACGGCTGCCGATTCGGGCACTCGCAAGCCCTATACCTGTCCTTCTCAGTCGCCATCATGCTCACGGGCTTCCTC
ACCGAGGTCGTCAAGGATGCGGTTGGCAGGCCTCGCCCCGACTTACTGGCTCGCTGCAGGCTGAAAAAGGACGCC
AAGCTGGAAGGTCTCGTCACTATAGAAGTATGCGACCTGCCGCACGATCGCAAGTTGCACGAAGGCTGGCGCTCC
TTTCCTTCCGGACACTCTTCCTTCTCCTTCGCCGGCCTCGGCTTCTTGAGTCTCTTCTTCGCCGGCCAGCTGCAC
CTATTTAGCCAGGCCGGGAATCGGGACCTCTGTCGTACACTGCTTTGCCTGAGCCCCCTCATCGGCGCCATGCTC
ATTGCCATCTCGCGATGCGAAGACTATCGTCACGACGTCTATGACGTCTGCAGCGGTTCCGCGCTGGGCATGTTC
ATCGCCTACTGGAGCTATCGAAGGCATTGGCCCAAGCTCTCTAGTCCCAAGTGTGACGTCCCCTTACCGCCACCC
GGTTCTGATACGCAAGCGTGGCAACGGATCGGGGATGAGGAAATGGGTGACCCCGGCTCGGAGCGTGGCTACGAA
TTGGGGAACCTGGCCAGAACGCGCTCCAGACAGCCGAGATAA
Gene >Ophun1|6951
ATGGCCCCATCCCCCTCCAATCCTCCTCCGACCACAGACGAGCGCGCCGTGGAGGCGTCCCGGGCGTGGTACGAT
GCCATCCAGCACGTACCCCAGGACGTCAATCCCGGGAGATAGCCGCCACATATCGCAACTGGCTCGAGTCTGGAA
GGTCAGGTCAGCGCGCCTCTAATGAATGCTGTCGCTGACGCCTTGAGCAGACGACTTACATGTCCGACTACGCCG
GCTTGGCTCTTCTGGGGATTGGACTGGGCCTCGTGAGTGCTCGTCTAGCGCTCTTCTGCTATGCCTTTTAGTCTG
ACCGTGCTCGTCTCCAAGTTAGCTACCTTCGTTACACCATTTCACCGTATGTTCTCCGTCAACGATCTTGCCATC
TCCTTTCCTCACGCCGAGCACGAGCGCGTCCCTACTTGTGAGTTCTCTAAGCTCGACTCATGCACTGGAGGCAAA
GCTTACATGTATACGACAGTCTGGGCCATCATTGCCGCCCTGGTATTCCCGCTACTCGTCTTCGTCTGCCACGGC
TGCCGATTCGGGCACTCGCAAGCCCTATACCTGTCCTTCTCAGTCGCCATCATGCTCACGGGCTTCCTCACCGAG
GTCGTCAAGGATGCGGTTGGCAGGCCTCGCCCCGACTTACTGGCTCGCTGCAGGCTGAAAAAGGACGCCAAGCTG
GAAGGTCTCGTCACTATAGAAGTATGCGACCTGCCGCACGATCGCAAGTTGCACGAAGGCTGGCGCTCCTTTCCT
TCCGGACACTCTTCCTTCTCCTTCGCCGGCCTCGGCTTCTTGAGTCTCTTCTTCGCCGGCCAGCTGCACCTATTT
AGCCAGGCCGGGAATCGGGACCTCTGTCGTACACTGCTTTGCCTGAGCCCCCTCATCGGCGCCATGCTCATTGCC
ATCTCGCGATGCGAAGACTATCGTCACGACGTCTATGACGTCTGCAGCGGTTCCGCGCTGGGCATGTTCATCGCC
TACTGGAGCTATCGAAGGCATTGGCCCAAGCTCTCTAGTCCCAAGTGTGACGTCCCCTTACCGCCACCCGGTTCT
GATACGCAAGCGTGGCAACGGATCGGGGATGAGGAAATGGGTGACCCCGGCTCGGAGCGTGGCTACGAATTGGGG
AACCTGGCCAGAACGCGCTCCAGACAGCCGAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail