Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|695
Gene name
LocationContig_122:18132..20893
Strand-
Gene length (bp)2761
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 3.1E-27 28 274
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.8E-15 364 639
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.9E-10 372 640
PF12146 Hydrolase_4 Serine aminopeptidase, S33 4.7E-08 365 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 347 473 2.0E-13
sp|Q02795|OSTD_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP1 PE=1 SV=1 73 271 2.0E-11
sp|C5CN82|RUTD_VARPS Putative aminoacrylate hydrolase RutD OS=Variovorax paradoxus (strain S110) GN=rutD PE=3 SV=1 350 467 4.0E-10
sp|O74943|YJB6_SCHPO Uncharacterized protein C553.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.06 PE=3 SV=1 3 205 7.0E-09
sp|Q59695|ACOC_PSEPU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Pseudomonas putida GN=acoC PE=3 SV=1 335 468 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8IAD8|RUTD_AZOC5 Putative aminoacrylate hydrolase RutD OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutD PE=3 SV=1 347 473 2.0E-13
sp|Q02795|OSTD_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP1 PE=1 SV=1 73 271 2.0E-11
sp|C5CN82|RUTD_VARPS Putative aminoacrylate hydrolase RutD OS=Variovorax paradoxus (strain S110) GN=rutD PE=3 SV=1 350 467 4.0E-10
sp|O74943|YJB6_SCHPO Uncharacterized protein C553.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.06 PE=3 SV=1 3 205 7.0E-09
sp|Q59695|ACOC_PSEPU Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system OS=Pseudomonas putida GN=acoC PE=3 SV=1 335 468 1.0E-08
sp|P00632|ELH2_ACIAD 3-oxoadipate enol-lactonase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catD PE=1 SV=3 374 516 2.0E-08
sp|D5VGV3|RUTD_CAUST Putative aminoacrylate hydrolase RutD OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutD PE=3 SV=1 352 466 5.0E-08
sp|B7KWT4|RUTD_METC4 Putative aminoacrylate hydrolase RutD OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutD PE=3 SV=1 355 466 5.0E-07
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 70 280 1.0E-06
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 70 280 1.0E-06
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 70 280 2.0E-06
sp|P9WNH1|BPOC_MYCTU Putative non-heme bromoperoxidase BpoC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bpoC PE=1 SV=1 350 471 3.0E-06
sp|P9WNH0|BPOC_MYCTO Putative non-heme bromoperoxidase BpoC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bpoC PE=3 SV=1 350 471 3.0E-06
sp|Q93Z16|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana GN=RPN2 PE=2 SV=1 15 274 4.0E-06
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 70 280 8.0E-06
sp|Q3SZI6|RPN2_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Bos taurus GN=RPN2 PE=2 SV=1 70 280 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008250 oligosaccharyltransferase complex Yes
GO:0016021 integral component of membrane Yes
GO:0006487 protein N-linked glycosylation Yes
GO:0019538 protein metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0006486 protein glycosylation No
GO:0070085 glycosylation No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0043412 macromolecule modification No
GO:0110165 cellular anatomical entity No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1990234 transferase complex No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.998388

Transmembrane Domains

Domain # Start End Length
1 185 207 22
2 222 244 22
3 249 268 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5701
Ophiocordyceps australis map64 (Brazil) OphauB2|7861
Ophiocordyceps camponoti-floridani Ophcf2|02361
Ophiocordyceps camponoti-rufipedis Ophun1|695 (this protein)
Ophiocordyceps kimflemingae Ophio5|4152
Ophiocordyceps subramaniannii Hirsu2|5247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|695
MRLLTASAVCLLVGAVSGASSWSFSDATVTASSKSAKSSSTKFSASKKIQEAVQLGPKDSIKLSLTTVDDEGNAK
RPHQALLMVGESSGLEVPFALTVKKSGKGTLQLSQKDLPPQLLLSQKPLHARLILGSSDSEKGLVTPAFDIALKL
DPITAAPSHDKPLRYLRQPEISHTFRGDPKSPPRIVSLAFALALIASVPTLVVAWLFFEANLGHAATAFSRAPVS
HAVFFGSVIGMEFVFYLYHGGWNLFRTLPVVCLVGVSAFLSGTKALGEVQRRRLAGESATERDKTAANSNGVVQM
ATDTDDMSSPSRFPTVEETLKHAAFPGVVWDLEPHSSGKATVASNRGGPLKLAWEIHGSGPIKVVLIMGLAGVMA
TWQRQTLYLGHERGNRFSVLLLDNRGVGLSDRPLGRYSTSEMARDVMDVLDEVGWTDDRQLHVVGISLGGMISQE
LACLIPKRLASLSLISTAAHLRGSEAPESSTSHFQQLVNGLGMLRPKSEAQTITDTARRVFTPSWLSAPDTATLP
TATTPRCRLPNHDAYPPRFVSNFQRFQAQELVKRRRVGFSRVGYLCQGVAAVWHYKSDEQLRAMADAVGRRRIMV
VHGREDAMIRLGYGIGLVEAVEPAVVHFVDGAGHAPCIEREGWFNNMLEQNLEAWNALGGEE*
Coding >Ophun1|695
ATGCGTCTCCTCACAGCCTCGGCGGTCTGTCTTCTCGTGGGCGCTGTCAGCGGAGCCTCCTCTTGGAGCTTCTCT
GATGCGACGGTCACAGCCTCGTCCAAGTCGGCCAAGAGCAGCAGCACAAAGTTTTCCGCATCCAAAAAGATCCAA
GAGGCCGTGCAGTTGGGTCCGAAAGACTCTATCAAGCTATCGCTGACCACGGTAGACGACGAAGGCAACGCGAAG
CGGCCGCATCAGGCCCTTCTCATGGTCGGGGAGTCGTCCGGCCTCGAGGTCCCTTTTGCCCTTACGGTCAAGAAA
TCCGGCAAAGGAACTCTTCAGCTTAGCCAAAAGGACCTCCCTCCGCAGCTGCTCCTCTCGCAGAAGCCATTGCAC
GCGAGACTCATCCTGGGCTCGTCCGATTCGGAAAAGGGATTGGTGACGCCCGCGTTCGATATCGCGCTGAAGCTG
GATCCTATCACGGCGGCCCCCAGCCACGACAAGCCACTTCGATACCTCCGGCAGCCCGAGATCAGCCACACATTT
CGTGGGGATCCCAAGAGCCCACCGCGAATCGTGTCGCTGGCCTTTGCCTTGGCTCTGATTGCCAGTGTTCCAACT
CTTGTGGTCGCGTGGCTGTTTTTCGAGGCCAACCTGGGGCACGCAGCAACAGCCTTTTCCCGCGCTCCCGTGTCT
CATGCCGTCTTTTTCGGATCCGTCATTGGGATGGAATTCGTCTTCTATCTCTACCACGGTGGTTGGAACCTGTTC
CGCACGCTCCCTGTCGTTTGCCTGGTCGGCGTCTCCGCCTTCCTGAGCGGGACTAAGGCGCTCGGCGAGGTGCAG
CGGCGACGACTCGCGGGCGAGAGCGCAACTGAGCGAGACAAGACGGCGGCCAACAGCAACGGCGTCGTTCAGATG
GCTACAGATACAGACGACATGTCCTCACCATCCCGCTTCCCAACGGTAGAAGAGACGCTCAAGCACGCCGCCTTC
CCGGGCGTCGTCTGGGATCTAGAGCCACACTCATCCGGCAAGGCAACAGTAGCCTCCAACCGAGGCGGACCACTG
AAGCTGGCATGGGAGATTCACGGCTCGGGCCCGATCAAGGTGGTGCTCATCATGGGCCTCGCGGGCGTCATGGCG
ACGTGGCAGCGGCAAACGCTGTATCTAGGCCACGAGCGCGGCAACCGCTTCTCCGTGCTGCTGCTGGACAATCGC
GGCGTTGGCCTCAGCGACCGGCCGCTTGGACGCTATTCCACCAGCGAGATGGCGCGCGATGTCATGGATGTGCTC
GATGAGGTTGGCTGGACGGATGACAGACAGCTTCACGTCGTCGGCATCTCGCTCGGGGGCATGATCTCACAGGAA
CTGGCCTGCCTGATCCCCAAGAGACTGGCCTCCCTGAGCCTGATTTCCACAGCCGCCCACCTTCGCGGCTCAGAA
GCACCAGAGTCATCGACCTCGCATTTCCAACAACTAGTCAACGGTCTCGGCATGCTACGACCCAAATCCGAGGCC
CAGACCATCACAGACACAGCCCGTCGCGTCTTCACCCCATCCTGGCTCTCCGCACCAGACACAGCCACCCTCCCC
ACGGCAACGACGCCCAGATGCCGCCTCCCAAACCACGATGCGTACCCTCCGCGCTTCGTCTCCAACTTCCAGCGC
TTCCAGGCGCAGGAGCTCGTCAAGAGGCGACGTGTCGGCTTCTCGCGCGTCGGGTATCTCTGTCAGGGCGTCGCT
GCCGTCTGGCACTACAAGTCGGACGAGCAGCTGCGGGCCATGGCTGATGCGGTGGGCCGTCGACGGATCATGGTG
GTTCATGGTCGTGAGGATGCCATGATTCGGCTTGGGTATGGGATTGGGCTTGTCGAGGCGGTTGAGCCGGCGGTT
GTGCACTTTGTCGATGGGGCGGGTCATGCGCCGTGCATTGAGCGGGAGGGTTGGTTTAATAATATGCTGGAGCAG
AATCTGGAGGCGTGGAATGCGTTGGGGGGGGAGGAGTGA
Transcript >Ophun1|695
ATGCGTCTCCTCACAGCCTCGGCGGTCTGTCTTCTCGTGGGCGCTGTCAGCGGAGCCTCCTCTTGGAGCTTCTCT
GATGCGACGGTCACAGCCTCGTCCAAGTCGGCCAAGAGCAGCAGCACAAAGTTTTCCGCATCCAAAAAGATCCAA
GAGGCCGTGCAGTTGGGTCCGAAAGACTCTATCAAGCTATCGCTGACCACGGTAGACGACGAAGGCAACGCGAAG
CGGCCGCATCAGGCCCTTCTCATGGTCGGGGAGTCGTCCGGCCTCGAGGTCCCTTTTGCCCTTACGGTCAAGAAA
TCCGGCAAAGGAACTCTTCAGCTTAGCCAAAAGGACCTCCCTCCGCAGCTGCTCCTCTCGCAGAAGCCATTGCAC
GCGAGACTCATCCTGGGCTCGTCCGATTCGGAAAAGGGATTGGTGACGCCCGCGTTCGATATCGCGCTGAAGCTG
GATCCTATCACGGCGGCCCCCAGCCACGACAAGCCACTTCGATACCTCCGGCAGCCCGAGATCAGCCACACATTT
CGTGGGGATCCCAAGAGCCCACCGCGAATCGTGTCGCTGGCCTTTGCCTTGGCTCTGATTGCCAGTGTTCCAACT
CTTGTGGTCGCGTGGCTGTTTTTCGAGGCCAACCTGGGGCACGCAGCAACAGCCTTTTCCCGCGCTCCCGTGTCT
CATGCCGTCTTTTTCGGATCCGTCATTGGGATGGAATTCGTCTTCTATCTCTACCACGGTGGTTGGAACCTGTTC
CGCACGCTCCCTGTCGTTTGCCTGGTCGGCGTCTCCGCCTTCCTGAGCGGGACTAAGGCGCTCGGCGAGGTGCAG
CGGCGACGACTCGCGGGCGAGAGCGCAACTGAGCGAGACAAGACGGCGGCCAACAGCAACGGCGTCGTTCAGATG
GCTACAGATACAGACGACATGTCCTCACCATCCCGCTTCCCAACGGTAGAAGAGACGCTCAAGCACGCCGCCTTC
CCGGGCGTCGTCTGGGATCTAGAGCCACACTCATCCGGCAAGGCAACAGTAGCCTCCAACCGAGGCGGACCACTG
AAGCTGGCATGGGAGATTCACGGCTCGGGCCCGATCAAGGTGGTGCTCATCATGGGCCTCGCGGGCGTCATGGCG
ACGTGGCAGCGGCAAACGCTGTATCTAGGCCACGAGCGCGGCAACCGCTTCTCCGTGCTGCTGCTGGACAATCGC
GGCGTTGGCCTCAGCGACCGGCCGCTTGGACGCTATTCCACCAGCGAGATGGCGCGCGATGTCATGGATGTGCTC
GATGAGGTTGGCTGGACGGATGACAGACAGCTTCACGTCGTCGGCATCTCGCTCGGGGGCATGATCTCACAGGAA
CTGGCCTGCCTGATCCCCAAGAGACTGGCCTCCCTGAGCCTGATTTCCACAGCCGCCCACCTTCGCGGCTCAGAA
GCACCAGAGTCATCGACCTCGCATTTCCAACAACTAGTCAACGGTCTCGGCATGCTACGACCCAAATCCGAGGCC
CAGACCATCACAGACACAGCCCGTCGCGTCTTCACCCCATCCTGGCTCTCCGCACCAGACACAGCCACCCTCCCC
ACGGCAACGACGCCCAGATGCCGCCTCCCAAACCACGATGCGTACCCTCCGCGCTTCGTCTCCAACTTCCAGCGC
TTCCAGGCGCAGGAGCTCGTCAAGAGGCGACGTGTCGGCTTCTCGCGCGTCGGGTATCTCTGTCAGGGCGTCGCT
GCCGTCTGGCACTACAAGTCGGACGAGCAGCTGCGGGCCATGGCTGATGCGGTGGGCCGTCGACGGATCATGGTG
GTTCATGGTCGTGAGGATGCCATGATTCGGCTTGGGTATGGGATTGGGCTTGTCGAGGCGGTTGAGCCGGCGGTT
GTGCACTTTGTCGATGGGGCGGGTCATGCGCCGTGCATTGAGCGGGAGGGTTGGTTTAATAATATGCTGGAGCAG
AATCTGGAGGCGTGGAATGCGTTGGGGGGGGAGGAGTGA
Gene >Ophun1|695
ATGCGTCTCCTCACAGCCTCGGCGGTCTGTCTTCTCGTGGGCGCTGTCAGCGGAGCCTCCTCTTGGAGCTTCTCT
GATGCGACGGTCACAGCCTCGTCCAAGTCGGCCAAGAGCAGCAGCACAAAGTGAGCCTTTCCTACCGCTGGCTGG
ACCGTGGCTGACCCAAAGCTTTACTACAGGTTTTCCGCATCCAAAAAGATCCAAGAGGCCGTGCAGTTGGGTCCG
AAAGACTCTATCAAGCTATCGCTGACCACGGTAGACGACGAAGGCAACGCGAAGCGGCCGCATCAGGCCCTTCTC
ATGGTCGGGGAGTCGTCCGGCCTCGAGGTCCCTTTTGCCCTTACGGTCAAGAAATCCGGCAAAGGAACTCTTCAG
CTTGTATTGTCTCCCCTTCCTTCTTCCCTTGCTCTGATGGCGGCTGCGAGAACACCAGCTAACGGGCATGGACGC
ACAGAGCCAAAAGGACCTCCCTCCGCAGCTGCTCCTCTCGCAGAAGCCATTGCACGCGAGACTCATCCTGGGCTC
GTCCGATTCGGAAAAGGGATTGGTGACGCCCGCGTTCGATATCGCGCTGAAGCTGGATCCTATCACGGCGGCCCC
CAGCCACGACAAGCCACTTCGATACCTCCGGCAGCCCGAGATCAGCCACACATTTCGTGGGGATCCCAAGAGCCC
ACCGCGAATCGTGTCGCTGGCCTTTGCCTTGGCTCTGATTGCCAGTGTTCCAACTCTTGTGGTCGCGGTACGTTT
TTTCCTATTCCAAATTCCCTTCCTTGTATTGGGTCCTGGCGGCGACTCCACGTGCCCGTTTGATCTTGAAAGGTC
CAGTTTCAACTAATGCTGTTTCGGGGGGGGGGGTGGTTAGTGGCTGTTTTTCGAGGCCAACCTGGGGCACGCAGC
AACAGCCTTTTCCCGCGCTCCCGTGTCTCATGCCGTCTTTTTCGGATCCGTCATTGGGATGGAATTCGTCTTCTA
TCTCTACCACGGTGGTTGGAACCTGTTCCGCACGCTCCCTGTCGTTTGCCTGGTCGGCGTCTCCGCCTTCCTGAG
CGGGACTAAGGCGCTCGGCGAGGTGCAGCGGCGACGACTCGCGGGCGAGAGGTAGGTACGCATAAGCCTACGGGG
GATCGGGCTGAAGACGGGGCCCGAAGCTGTCACCCCCCCTTTCAGCCACGGTCATGCGGGATCGGGGGGAACGTG
CTCGGAGCGTTTCGTTTGTGTATGTGACCGAGTCGCATCAGCGGGGGAACGACCGTCTTGCTGTTGACCATCTGA
AGCAGTCCAACGCTAGAGCCATGGGTATTTGGCACTATGTCGCAGGATGCTGACGGGTGGTCGGCGATGTCCGAC
AGGGGCTGGGGGGTTGGAGGGGAGCAATGGCGCTTCTAGTACCTATAGTATTTGACGATGGCCGTATCCAAACCA
TGACACTGTTTTGTTGCAGACTCTCTTGACGGTGCAGGTACGCGAGACAATCATGACAATGACAACGACAACGAC
GACGGAAAGCGCAACTGAGCGAGACAAGACGGCGGCCAACAGCAACGGCGTCGTTCAGATGGCTACAGATACAGA
CGACATGTAAGCCGTCGTCATAAATTCCAATCAACCACAGCTGACGATGAATCCAGGTCCTCACCATCCCGCTTC
CCAACGGTAGAAGAGACGCTCAAGCACGCCGCCTTCCCGGGCGTCGTCTGGGATCTAGAGCCACACTCATCCGGC
AAGGCAACAGTAGCCTCCAACCGAGGCGGACCACTGAAGCTGGCATGGGAGATTCACGGCTCGGGCCCGATCAAG
GTGGTGGTGAGCATCCCCTTTGCGCATGCTCAGACGTCAGTCAGCTAACGCGTCATCCCTCACCAAGCTCATCAT
GGGCCTCGCGGGCGTCATGGCGACGTGGCAGCGGCAAACGCTGTATCTAGGCCACGAGCGCGGCAACCGCTTCTC
CGTGCTGCTGCTGGACAATCGCGGCGTTGGCCTCAGCGACCGGCCGCTTGGACGCTATTCCACCAGCGAGATGGC
GCGCGATGTCATGGATGTGCTCGATGAGGTTGGCTGGACGGATGACAGACAGCTTCACGTCGTCGGCATCTCGCT
CGGGGGCATGATCTCACAGGAACTGGCCTGCCTGATCCCCAAGAGACTGGCCTCCCTGAGCCTGATTTCCACAGC
CGCCCACCTTCGCGGCTCAGAAGCACCAGAGTCATCGACCTCGCATTTCCAACAACTAGTCAACGGTCTCGGCAT
GCTACGACCCAAATCCGAGGCCCAGACCATCACAGACACAGCCCGTCGCGTCTTCACCCCATCCTGGCTCTCCGC
ACCAGACACAGCCACCCTCCCCACGGCAACGACGCCCAGATGCCGCCTCCCAAACCACGATGCGTACCCTCCGCG
CTTCGTCTCCAACTTCCAGCGCTTCCAGGCGCAGGAGCTCGTCAAGAGGCGACGTGTCGGCTTCTCGCGCGTCGG
GTATCTCTGTCAGGGCGTCGCTGCCGTCTGGCACTACAAGTCGGACGAGCAGCTGCGGGCCATGGCTGATGCGGT
GGGCCGTCGACGGATCATGGTGGTTCATGGTCGTGAGGATGCCATGATTCGGCTTGGGTATGGGATTGGGCTTGT
CGAGGCGGTTGAGCCGGCGGTTGTGCACTTTGTCGATGGGGCGGGTCATGCGCCGTGCATTGAGCGGGAGGGTTG
GTTTAATAATATGCTGGAGCAGAATCTGGAGGCGTGGAATGCGTTGGGGGGGGAGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail