Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6941
Gene name
LocationContig_809:203..1695
Strand-
Gene length (bp)1492
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 5.3E-35 268 412

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53933|APP1_YEAST Phosphatidate phosphatase APP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APP1 PE=1 SV=1 259 414 1.0E-06

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016791 phosphatase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 13 0.985445

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6030
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05774
Ophiocordyceps camponoti-rufipedis Ophun1|6941 (this protein)
Ophiocordyceps kimflemingae Ophio5|5240
Ophiocordyceps subramaniannii Hirsu2|1199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6941
MLLLLALAAVAVCSPTPSPTSQPVVPTIVPAATPPPDPVAVERRGLGNAKSYLSSLAGEAGSKVASFVDSGVLDF
PRGFPTGTEVEKQAGVSASEVEARPTEVLNIPPYANWTDQGWNVRVHGNVYRTPNISQEKIDKLANVFLIDVDVD
KLQPGEQAQARNLTRAIFVVGEGDRSVTMDFVNDVSVRANASGGAVNATGGAQTIRLPFNTTRQGDFDVFVPLKN
TTTNGRGLMPGNETSRVQTINLYAQGTDTGNATAYLVPTRGVTIVSDIDDILRVTKIYQPKEGLLNTFARPFRPW
MNMPDIYANWSRSVPDAHFHYLTTTPEQGTRLYMDFIYKTYPLGSFDTRPLNFSDVKATLSIRKFLLEKVIATFP
ERKFVLVADTSNRDVMRDYPLMYREHPEQVSCILLRNTSATDEADKFPYDTKGFRDVPREKYIA*
Coding >Ophun1|6941
ATGCTGCTGCTGCTGGCGCTCGCCGCCGTCGCCGTCTGCAGTCCGACCCCCTCGCCGACGTCGCAGCCGGTGGTC
CCCACGATTGTTCCGGCCGCGACGCCGCCGCCCGACCCGGTAGCGGTAGAGAGGCGCGGCCTCGGCAACGCCAAG
AGTTATCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCCTTTGTCGACTCGGGCGTCCTGGACTTC
CCGCGCGGGTTCCCTACCGGCACCGAGGTTGAGAAGCAGGCTGGCGTGTCGGCTTCTGAGGTGGAGGCGAGACCT
ACCGAGGTTCTCAACATTCCGCCGTATGCCAACTGGACGGATCAAGGATGGAACGTACGCGTTCACGGAAACGTC
TACCGCACGCCCAACATCTCGCAGGAGAAGATTGACAAGCTGGCCAATGTCTTTCTCATCGACGTCGACGTCGAT
AAGTTGCAGCCGGGGGAGCAGGCGCAGGCGCGGAACCTGACGCGTGCCATCTTTGTGGTTGGGGAGGGGGATCGG
AGCGTGACGATGGATTTTGTGAATGATGTTTCGGTGAGGGCGAATGCTTCGGGCGGTGCTGTCAATGCTACTGGA
GGAGCGCAGACGATTCGGTTGCCCTTCAACACGACCAGGCAGGGCGACTTTGACGTCTTTGTCCCCCTCAAGAAC
ACGACAACCAACGGCCGCGGCCTCATGCCCGGAAACGAAACCTCTCGCGTGCAGACCATCAACCTCTACGCCCAG
GGCACAGACACAGGCAACGCAACCGCCTACCTCGTCCCCACCCGGGGCGTAACCATCGTCTCCGACATCGACGAC
ATCCTCCGCGTCACCAAAATCTACCAGCCGAAAGAGGGCCTGCTCAATACCTTTGCCCGTCCCTTCCGTCCGTGG
ATGAACATGCCGGACATTTACGCCAACTGGTCGCGATCCGTCCCGGACGCGCACTTTCACTACCTCACCACGACG
CCCGAGCAGGGGACGCGCCTGTACATGGACTTCATATACAAGACGTACCCGCTCGGCTCCTTCGACACGCGGCCT
CTGAACTTTTCCGACGTCAAGGCTACCTTGTCGATTCGCAAGTTCCTGCTGGAAAAGGTGATTGCTACCTTTCCC
GAGAGGAAGTTTGTGCTCGTGGCCGATACTTCGAACCGGGACGTCATGAGAGATTACCCTCTCATGTACCGCGAG
CATCCGGAGCAGGTGAGCTGCATCCTCCTGCGCAACACGAGCGCAACGGACGAAGCCGACAAGTTCCCCTACGAC
ACCAAGGGGTTCCGCGACGTGCCGCGCGAGAAATACATTGCTTGA
Transcript >Ophun1|6941
ATGCTGCTGCTGCTGGCGCTCGCCGCCGTCGCCGTCTGCAGTCCGACCCCCTCGCCGACGTCGCAGCCGGTGGTC
CCCACGATTGTTCCGGCCGCGACGCCGCCGCCCGACCCGGTAGCGGTAGAGAGGCGCGGCCTCGGCAACGCCAAG
AGTTATCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCCTTTGTCGACTCGGGCGTCCTGGACTTC
CCGCGCGGGTTCCCTACCGGCACCGAGGTTGAGAAGCAGGCTGGCGTGTCGGCTTCTGAGGTGGAGGCGAGACCT
ACCGAGGTTCTCAACATTCCGCCGTATGCCAACTGGACGGATCAAGGATGGAACGTACGCGTTCACGGAAACGTC
TACCGCACGCCCAACATCTCGCAGGAGAAGATTGACAAGCTGGCCAATGTCTTTCTCATCGACGTCGACGTCGAT
AAGTTGCAGCCGGGGGAGCAGGCGCAGGCGCGGAACCTGACGCGTGCCATCTTTGTGGTTGGGGAGGGGGATCGG
AGCGTGACGATGGATTTTGTGAATGATGTTTCGGTGAGGGCGAATGCTTCGGGCGGTGCTGTCAATGCTACTGGA
GGAGCGCAGACGATTCGGTTGCCCTTCAACACGACCAGGCAGGGCGACTTTGACGTCTTTGTCCCCCTCAAGAAC
ACGACAACCAACGGCCGCGGCCTCATGCCCGGAAACGAAACCTCTCGCGTGCAGACCATCAACCTCTACGCCCAG
GGCACAGACACAGGCAACGCAACCGCCTACCTCGTCCCCACCCGGGGCGTAACCATCGTCTCCGACATCGACGAC
ATCCTCCGCGTCACCAAAATCTACCAGCCGAAAGAGGGCCTGCTCAATACCTTTGCCCGTCCCTTCCGTCCGTGG
ATGAACATGCCGGACATTTACGCCAACTGGTCGCGATCCGTCCCGGACGCGCACTTTCACTACCTCACCACGACG
CCCGAGCAGGGGACGCGCCTGTACATGGACTTCATATACAAGACGTACCCGCTCGGCTCCTTCGACACGCGGCCT
CTGAACTTTTCCGACGTCAAGGCTACCTTGTCGATTCGCAAGTTCCTGCTGGAAAAGGTGATTGCTACCTTTCCC
GAGAGGAAGTTTGTGCTCGTGGCCGATACTTCGAACCGGGACGTCATGAGAGATTACCCTCTCATGTACCGCGAG
CATCCGGAGCAGGTGAGCTGCATCCTCCTGCGCAACACGAGCGCAACGGACGAAGCCGACAAGTTCCCCTACGAC
ACCAAGGGGTTCCGCGACGTGCCGCGCGAGAAATACATTGCTTGA
Gene >Ophun1|6941
ATGCTGCTGCTGCTGGCGCTCGCCGCCGTCGCCGTCTGCAGTCCGACCCCCTCGCCGACGTCGCAGCCGGTGGTC
CCCACGATTGTTCCGGCCGCGACGCCGCCGCCCGACCCGGTAGCGGTAGAGAGGCGCGGCCTCGGCAACGCCAAG
AGTTATCTGTCCAGCCTGGCGGGCGAGGCGGGCAGCAAGGTGGCTTCCTTTGTCGACTCGGGCGTCCTGGACTTC
CCGCGCGGGTTCCCTACCGGCACCGAGGTTGAGAAGCAGGCTGGCGTGTCGGCTTCTGAGGTGGAGGCGAGACCT
ACCGAGGTTCTCAACATTCCGTGAGTACACATGTCCCCGTTTGCACTGCAGACGTCGGGTGGCTAAACTGAGAAC
AGGCCGTATGCCAACTGGACGGATCAAGGATGGAACGTACGCGTTCACGGAAACGTCTACCGCACGCCCAACATC
TCGCAGGAGAAGATTGACAAGCTGGCCAATGTCTTTCTCATCGACGTCGACGTCGATAAGTTGCAGCCGGGGGAG
CAGGCGCAGGCGCGGAACCTGACGCGTGCCATCTTTGTGGTTGGGGAGGGGGATCGGAGCGTGACGATGGATTTT
GTGAATGATGTTTCGGTGAGGGCGAATGCTTCGGGCGGTGCTGTCAATGCTGTGAGTTTCGGAGTTGCTGAAGTT
GTCACTGAAGTTGTGACTCTGACTGACGACCTTCGACAGACTGGAGGAGCGCAGACGATTCGGTTGCCCTTCAAC
ACGACCAGGCAGGGCGACTTTGACGTCTTTGTCCCCCTCAAGAACACGACAACCAACGGCCGCGGCCTCATGCCC
GGAAACGAAACCTCTCGCGTGCAGACCATCAACCTCTACGCCCAGGGCACAGACACAGGCAACGCAACCGCCTAC
CTCGTCCCCACCCGGGGCGTAACCATCGTCTCCGACATCGACGACATCCTCCGCGTCACCAAAATCTACCAGCCG
AAAGAGGGCCTGCTCAATACCTTTGCCCGTCCCTTCCGTCCGTGGATGAACATGCCGGACATTTACGCCAACTGG
TCGCGATCCGTCCCGGACGCGCACTTTCACTACCTCACCACGACGCCCGAGCAGGGGACGCGCCTGTACATGGAC
TTCATATACAAGACGTACCCGCTCGGCTCCTTCGACACGCGGCCTCTGAACTTTTCCGACGTCAAGGCTACCTTG
TCGATTCGCAAGTTCCTGCTGGAAAAGGTGATTGCTACCTTTCCCGAGAGGAAGTTTGTGCTCGTGGCCGATACT
TCGAACCGGGACGTCATGAGAGATTACCCTCTCATGTACCGCGAGCATCCGGAGCAGGTGAGCTGCATCCTCCTG
CGCAACACGAGCGCAACGGACGAAGCCGACAAGTTCCCCTACGACACCAAGGGGTTCCGCGACGTGCCGCGCGAG
AAATACATGTTCTTCACCGTGCCGGATGATCTGGTGGGCTTGGATGTCTTGGGGGGTCAGTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail